CAZyme Information: MGYG000003172_00052

Basic Information

• Species: CAG-485 sp900555915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900555915
• CAZyme ID: MGYG000003172_00052
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1221		138000.46	5.1629

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003172	1933519	MAG	United States	North America

• Gene Location: Start: 8294; End: 11959 Strand: -

Full Sequence      

MMLLAASCSTILYVSGQNLHNDFSDAAQTLRTMGRGTSRVSDGVLTTKGQYVLFGNPDWK
NYSVSFRARAPKDAEQVQIWAGFRTRNRFDRYVLGIKGGLQDDIYLMRTGYMGTDELMGV
RPLGFHPEPGDWIDVRIEVCGKRMRVFVNDSRYPYIDVEDNNGWQLAETGEIALGGGWIE
TEFDELKVSPLADDAFKDVSNKEMSFVLSPAQKEAKRKKERAAYSPKKLQTLDGVRTEFS
LDGDWLFMPTYQMDDTSKAIDNSQDDSDWHVMNVPDFWSPIRIWLHGETMPSPRGSQPKG
VSDTYYQKETDRCENYTFDHRKTKGAWYRQWLELPSDIKGKKLTLQFDAVSKVAEVYVNG
HKAASHIGMFGNFDVDATPYLHAGKNLIAINVVRDIKGAGPQTSDAMENFYSSVRKDVED
NKNDATANAEVIADIPHGFFGDNPAGIWQPVKLVVSDPLLVEDVYVKPSLTGADFEITVG
NNSSKKRKFDIAVSITDKKTGEPLYSGTLLKKLSQQPGTEETYMAAVDGLAPKLWEPETP
NLYDFRFSLLEGKKESDEYAVTSGFRTFETKDGFFYLNGRKFWLRGGNHIPFSLGMNNEA
LADKFMSMMREGNVNSTRTHTTPWNQLWMDAADRNGIAVSFEGTWSWLMIHSTPIPSQAT
LDLWSNEWFQVMKKFRNHPSIIFWTINNEMKFYDLDADTERAKKKMHIISDVVKDMREVD
PTRPISFDSNYMRRNGVNRFGEEFMSTVDDGDIDDNHAYYNWYDYSVFRFFNGEFEKNFR
TPGRPLISQEMSTGYPNAETGHPTRSYQLIHQNPYSLIGYEAYDFADPAGFLKVQSFITG
ELAEALRRSNPNASGIMHFAYMTWFRQCYDENKIAPWPTYYAMQRAMQPVLVSAELWGRN
YYAGERIPTRIYVVNDNNEGRDLGQTELTWTILDGHGNQAATGSETFPEVAYYGREYIEP
AITVPENISDGKCYGKLRLSLKENGKEISSNEYDLTFAPRTWAEVSSDGQKIMYLGNDAA
LASLNAVGVDCVKAVSVAEMVGKKKKSDLCIIAGLDSLTAVEAGLLRDYQSKGGRLLVLD
GRNIVETLYPEYVTGVIIPTEGDIVVMERSDDDVFDGLDPLDLRYFNNNKREIPLACNAT
LKTVRNDNLKELASQMKIHAYIDGGAPEDRIRKIESMRGLTMMEIADGKGKAIVSTMTTD
RAATDPIAGRLLANMVRQAMK

Enzyme Prediction     

No EC number prediction in MGYG000003172_00052.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	228	984	4.5e-90	0.7367021276595744

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.51e-39	327	894	66	636	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.04e-34	326	763	67	476	beta-D-glucuronidase; Provisional
PRK10340	ebgA	2.06e-19	328	723	113	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	1.47e-18	568	808	1	235	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	1.19e-13	240	394	3	135	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO76883.1	0.0	21	1221	30	1231
QMW88738.1	0.0	21	1221	30	1231
QQA09898.1	0.0	21	1221	30	1231
ALJ40807.1	0.0	21	1221	30	1231
BCA51188.1	0.0	21	1221	30	1231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GM8_A	3.05e-29	251	743	15	454	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5T98_A	4.65e-27	263	731	48	453	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
6B6L_A	3.47e-25	238	730	7	439	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	6.07e-25	238	730	7	439	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6SD0_A	2.05e-24	240	689	41	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	7.71e-26	236	746	51	487	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q56307	1.12e-23	240	689	41	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
T2KM09	2.85e-22	233	689	43	432	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	2.49e-19	236	706	3	406	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
Q6LL68	2.59e-19	233	728	40	482	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.825289	0.149807	0.024414	0.000153	0.000126	0.000225

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003172_00052.