CAZyme Information: MGYG000003172_00423

Basic Information

• Species: CAG-485 sp900555915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900555915
• CAZyme ID: MGYG000003172_00423
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		53576.77	4.2957

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003172	1933519	MAG	United States	North America

• Gene Location: Start: 3579; End: 5009 Strand: -

Full Sequence      

MNLNYMTLLLVALLFWNCGHDEAATVDNPYVRFTEVGTDIVLSELEVECFPVSAMIDVNA
NVDWRLDCDAEWVSLSNFSGTPIDPDVEYQQVHIKLTVDENTGDRPRTASIRLTGGGQSS
VLTLTQLSETDSSGSMTAAAVVNDIVAGWNMGNTLDAQGDWFDADDIVAWETCWGQPLTT
REMIHAFREKGFNAIRVPVTWWGHLDSGGNVKESWMARVEEVVGYVLDEGMYCILNVHHD
TGNPGVGEAGWLRADPSNRDFILDRYTRLWRQIAARFAHHDPRLIFGAFNEILDSRTNWD
STDDVNYDFVNELAQTFVNEVRQSGGNNEQRCLVIPTYAASHNARALNAWRLPDDPTPRR
IIAEVHMYSPWQFAGDSEDMSAIEFTAAGRKEVDEIIDRVATRFVNRGIPVVFGELGAAD
KDNMDQRVDYADYVVSHARERGIKCLWWMGLLDRQSVIWYEPDLADAIINAANNLK

Enzyme Prediction     

EC	3.2.1.-	3.2.1.4	3.2.1.73	3.2.1.78	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	171	449	3e-95	0.9818840579710145

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.27e-55	155	448	1	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	6.28e-23	148	448	54	357	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	2.06e-13	43	126	7	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	2.20e-06	62	126	1	60	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.
pfam19190	BACON_2	0.001	50	126	20	88	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX63738.1	1.14e-117	29	472	44	479
AEX97596.1	8.17e-88	136	471	33	379
QPB75690.1	9.31e-87	10	469	3	498
AHF24720.1	2.60e-86	136	448	42	359
ACA61144.1	9.54e-83	138	471	147	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MQ4_A	2.91e-71	136	472	10	349	ChainA, cellulase [Acetivibrio cellulolyticus]
6WQP_A	3.00e-71	136	469	14	353	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
6PZ7_A	2.25e-68	136	470	7	335	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
6Q1I_A	1.18e-67	129	475	5	356	GH5-4broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum],6Q1I_B GH5-4 broad specificity endoglucanase from Clostrdium longisporum [Clostridium longisporum]
4IM4_A	1.76e-63	136	472	5	335	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54937	5.10e-66	129	475	30	381	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P28621	6.14e-60	136	472	40	374	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P10477	3.78e-59	136	472	55	385	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P17901	1.04e-58	142	476	51	404	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P23661	2.28e-58	127	466	57	394	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000511	0.336871	0.662111	0.000216	0.000146	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003172_00423.