CAZyme Information: MGYG000003176_00311

Basic Information

• Species: UMGS905 sp900546735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS905; UMGS905 sp900546735
• CAZyme ID: MGYG000003176_00311
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
985		112634.48	7.7794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003176	1982744	MAG	United States	North America

• Gene Location: Start: 5120; End: 8077 Strand: +

Full Sequence      

MQYTINKSNYRTFGKFAENRLEHRSYFISFHAEQAMQKTDWFSERFESDAVTMLSGEWDF
IYYRHASQLPKNFDTDKAEFQRIHVPSTWQKTGYDTVNYLNSRYPFACRPPKTPKNCPVG
VYRKQFSLCPSEDGHYILTFLGVCASLDLYLNGVYIGYSEGSHNSAEFDVTKFLRSGENE
IVAVVYKWSTGTYLECQDMFRENGIFRDVYITAQKKTYLFDFSFQTEKAGRGYNARVTAD
IRGAKGARWKAELFSSNGRIASETADAGKDIRFENLQVVEWNAEIPTCYDLVLTLLSGEH
VLECTRQKVGFRTIQIDGCRFFFNNKLIKLKGVNHHDTHPVRGYAMTAADLKKDVELMKA
YNVNCVRTSHYPPDPLFVTMCDVYGIYLVDEADMESHGCYKPKWIGDNPKWEPRFLDRMS
ALYERDKNHTCIIMWSMGNECTGIRNFDVSYAYLKSKTTIPVHYEPACRTERVRYDILAH
FYTSPDDMRALARGEWKGNKNYDAPFFLCEYAHSMGVGPGGLDEYWNVIYSDDRFLGGCI
WEWADHAHYSAAAKYKYTYGGDNGDRKNDGNFCCDGLFFPDRTPSPSAFCMKNVYSPLQA
AYQNGKLLVTNTNRFASSEGIQIAYYLLKNGQKSEISYYDAVLQPEQTAELRADFQYGDT
DDVFLILTYTQKKTGNVVGLDQIMLQEALPQAAVRRQAVNWKQIGSCLCLEDAKRKIAWD
RDGNLCCLTDRNGRDMLQNGSRGFVVQLAQALIDNQAYMKWPLKKAGVFHLRSGSGKRRY
DDYLNTVSTIFPLFAGVKKRFSVVIESKAVMANKVRVTFTLTSLYKKPLDLPQIGLTLQL
AGAYRNVRYYGMGDAECYSDFSKQSVMGVYTTRAEDMYVEYIKPQESGNRCGVRWAEVTD
DTGAGVRITAIGQPLHFKAVDVEEKNLQTAKHREDVRRVDAAILHINGFMRGIGSASCGP
DTASQYKKVLHYKESYTYAFDIEII

Enzyme Prediction     

No EC number prediction in MGYG000003176_00311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	37	865	3.8e-157	0.976063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	0.0	9	982	3	997	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.67e-175	19	972	26	1020	beta-galactosidase.
COG3250	LacZ	3.24e-111	54	633	15	593	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	9.18e-84	314	599	1	301	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02929	Bgal_small_N	1.94e-48	814	982	67	230	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC68480.1	4.87e-205	1	967	1	965
QTE70748.1	5.95e-203	1	967	1	965
QTE74712.1	1.84e-201	1	976	1	976
QUA54413.1	3.18e-201	1	967	1	965
SIP63360.1	3.63e-199	1	967	1	963

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DEC_A	3.88e-130	47	978	40	992	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	7.16e-128	47	966	44	985	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6S6Z_A	6.94e-119	54	954	41	953	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	7.07e-119	54	954	42	954	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
1PX3_A	1.53e-116	48	967	48	1008	ChainA, beta-galactosidase [Escherichia coli],1PX3_B Chain B, beta-galactosidase [Escherichia coli],1PX3_C Chain C, beta-galactosidase [Escherichia coli],1PX3_D Chain D, beta-galactosidase [Escherichia coli],1PX4_A Chain A, beta-galactosidase [Escherichia coli],1PX4_B Chain B, beta-galactosidase [Escherichia coli],1PX4_C Chain C, beta-galactosidase [Escherichia coli],1PX4_D Chain D, beta-galactosidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70753	1.30e-150	19	967	16	985	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
O33815	1.62e-133	19	967	16	979	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
P06864	3.81e-132	18	967	12	985	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q7MG04	4.45e-127	54	954	50	1000	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1
Q8D4H3	6.34e-127	54	954	50	1001	Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000007	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003176_00311.