CAZyme Information: MGYG000003176_00313

Basic Information

• Species: UMGS905 sp900546735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS905; UMGS905 sp900546735
• CAZyme ID: MGYG000003176_00313
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		46446.76	5.8568

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003176	1982744	MAG	United States	North America

• Gene Location: Start: 10237; End: 11478 Strand: +

Full Sequence      

MHKTVRVAMIGMGERGKQLMDPLLKMKDVQVVAVCDAYEDRTAAAAETVKKECGSAPFMS
QDYKEVLSHGDVDVAVISTSWQYHIAIAIEAMKQGVFAAMEVGGTYDLQECYDLVQAYEE
TKTPFFFLENCCYGHRELMCLNMARAGAFGELVHCDGAYKHDLRKEVSYGKENRHYRLPH
YIHHNCENYPTHDLGPIAKILGINRGNRMLRLVSVASKARGLAQYIRDHKPDDAELLNTE
FRQGDIVTTVITCENGETITLTLDTTLPRIYSRNFTVHGTKGMYQEDGDYVFLEKDLKVD
IAEIDTDPQKIWKNADEYAKVYDNDLWKHKSAGMIASGHGGMDYLVLRAMLSAARGESYP
AIDVYDAASWMCITALSEQSIASGNMPVEIPDFTNGKYKNRTEKSTGKYALDF

Enzyme Prediction     

No EC number prediction in MGYG000003176_00313.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	3	400	7.5e-141	0.9874686716791979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.89e-15	3	355	2	330	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.03e-07	5	122	1	113	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK13303	PRK13303	7.43e-05	4	105	1	114	aspartate dehydrogenase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	6.61e-158	3	401	2	398
QJD87109.1	1.26e-150	1	398	1	394
ALS29040.1	5.66e-148	1	401	1	398
QTH43530.1	5.68e-147	1	401	1	398
QTH41319.1	6.98e-147	1	398	4	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	1.17e-94	3	400	19	433	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	4.39e-66	5	399	43	439	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	6.40e-94	3	400	19	433	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	1.31e-86	3	401	32	444	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	1.13e-84	5	401	50	460	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	2.50e-80	5	401	53	462	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
Q01S58	1.16e-76	4	401	42	435	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003176_00313.