CAZyme Information: MGYG000003176_00885

Basic Information

• Species: UMGS905 sp900546735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS905; UMGS905 sp900546735
• CAZyme ID: MGYG000003176_00885
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
819	MGYG000003176_48|CGC1	89516.69	5.0811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003176	1982744	MAG	United States	North America

• Gene Location: Start: 2636; End: 5095 Strand: +

Full Sequence      

MKHPEIVSQMPLEEKVRLVSGKDYWHAKGSEKFGLPVIMLTDGPHGLRKQNPNPSKEDKK
IGLGNSVPATCMPPAATNVCAWDPALVYKMGQALADECIHEKVSVILGPGANIKRSPLCG
RNFEYFSEDPYLAGKNAAALINGIQSKGIGASLKHFACNSQEAFRMVVNEAIDERAMREL
YLAQYEIAVKESQPWTVMNAYNRLNGTYCSQSEWLQQKVLRDEWGFKGLIVTDWGASVDR
VEGVKYGTDLEMPSSGEYNTQKLIDAVQNGTLPEADLDARVDNVVELILKAKETLENAKD
ECDYDRNHEVAREVAEGSMVLLKNDGAVLPLKKGARLAVIGEMAKSPRYQGAGSSVINPT
KIDNALDSLKALGFTCDFAQGYKKGVDQRDDILVKEAVSKAKTADVAIVFAGLTEEFEAE
GYDRQSIDIPQCHNDLIEAVSAANENTVVVLAGGSVMRMPWIGSVKGVLHSLLGGQAGGS
AVARLLTGAVNPSGKLAETYPLSLEDNPTWGNYPGKVASEHKESVYIGYRYYDTAKKDVL
FPFGYGLSYTQFAYSDLQLSAAKIQDTDEVTVTFKVKNTGSVDGAEVAQLYVKDTESTIF
RPEKELKGYQKVFLKAGEEQVITLTLSKRAFAFYNVNLGDWQVESGNFEILVGASSRDIR
LQADLTVESTCTAEIPDYHKTAPSYYTADVQNISDQEWSAVYGELPCRTVDTSAPITIYN
CLDDARHTKWGGRICRLISGIMSKFGSAENGDGKMLQEMALQIPIRNFVAMSMGVFSEKM
AEGLLQILNDDQSSGKGLCKILAGIPHALANLKPLLSAI

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	253	3.4e-60	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.52e-104	32	660	101	758	beta-glucosidase BglX.
COG1472	BglX	3.45e-64	34	347	59	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.30e-63	319	549	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	7.30e-61	6	618	56	734	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.30e-36	69	287	85	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS53344.1	5.36e-265	1	802	1	799
CAJ35242.1	1.18e-258	6	795	8	799
QEN03854.1	3.08e-255	5	795	7	799
AGS53563.1	5.94e-254	1	803	1	801
AEF82048.1	2.55e-252	1	789	1	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.22e-242	5	670	7	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.69e-214	7	668	9	664	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.62e-135	5	667	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.47e-134	5	667	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.03e-120	5	668	8	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	3.32e-242	5	790	7	753	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.63e-207	7	668	9	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	3.68e-206	7	659	9	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.86e-138	5	660	48	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	5.63e-126	6	669	14	840	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003176_00885.