CAZyme Information: MGYG000003176_01355

Basic Information

• Species: UMGS905 sp900546735
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS905; UMGS905 sp900546735
• CAZyme ID: MGYG000003176_01355
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
664	MGYG000003176_96|CGC1	73770.06	4.2431

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003176	1982744	MAG	United States	North America

• Gene Location: Start: 5979; End: 7973 Strand: -

Full Sequence      

MKFFSKVWDAIHTRTATYVFFVLSALAYVFLNGAAWSYSWIAQLYPGGSQFVPTMLGVII
AVAAVHLAYLLYLSFTDRKKKSKLNTALKIIHTIFILLSIMLFVYTLVLVFGLDSGISSD
NIARGFEAIAANLVIVILAFVLPLALLFCESPKKALRGTIAAVVVGALAVSPMLINSGSS
NKWDGDKIAPYEMQSENLMEGASIVYESLKQDEKPDAAALLEDNDDCWTPQDPDRMPADS
TADINNSYVEIQLAQTSTFNTAVIEEVGNEAQYFRLQALQGEEWVTIYQSEKIQTSRLCS
FDAVTTDRIRLSIDKFRSTDTPVKIRSIQLYNEPVRDAKDFEVTAYQRLDGDVPTEILAK
GEEYVNNYARFYDVYSTVIVFGATHWQEDGTLGFGEGGEEKFAREVEALKEIIAHRSNPD
HEVKLIITALADGTWGEGHNGVNGYMAENWETVADQIVEFLNKYDFDGVDIDWEYPQTPD
DWKTYDQFIARLDDGMHETNPDAILTAALSAGSLGMAAETLDRFDQIQFMAYDGSDEDGY
QSSLQQAQEGMKAFIDAGADISKINIGIAAYGRPVNGTPYWGTWRDLADATYWNNKYFTV
YDSDQVYEGTFCSPALAGDKTAYALFSGAGGVMVFRVACDKTMDDPNSVACGIENALKRY
VANW

Enzyme Prediction     

EC	3.2.1.14	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	392	647	8.3e-35	0.8344594594594594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	3.06e-27	377	635	24	302	Glycosyl hydrolases family 18.
smart00636	Glyco_18	4.37e-26	366	640	10	334	Glyco_18 domain.
cd06548	GH18_chitinase	7.47e-24	367	633	30	315	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd02872	GH18_chitolectin_chitotriosidase	1.16e-17	398	573	53	245	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
cd00598	GH18_chitinase-like	5.62e-16	378	533	27	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAX32943.1	2.79e-12	367	661	56	384
AEE61812.1	1.97e-11	428	640	107	357
QNK64943.1	2.86e-11	409	576	79	241
QFU83914.1	3.04e-11	387	642	284	592
SCD19272.1	3.57e-11	409	645	79	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	6.25e-11	366	649	71	415	ChainA, Glycosyl Hydrolase [Niallia circulans]
3G6L_A	9.55e-09	426	645	107	371	Thecrystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea [Clonostachys rosea],3G6M_A crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with a potent inhibitor caffeine [Clonostachys rosea]
1GUV_A	1.92e-08	392	573	45	248	Structureof human chitotriosidase [Homo sapiens]
1D2K_A	2.81e-08	428	642	89	350	ChainA, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1HKK_A	3.36e-08	392	573	45	248	Highresoultion crystal structure of human chitinase in complex with allosamidin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	5.69e-10	366	649	103	447	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
C5P230	1.71e-07	428	642	124	385	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
Q1E3R8	1.71e-07	428	642	124	385	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
P0CB51	1.71e-07	428	642	124	385	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
Q13231	2.46e-07	392	573	66	269	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
19	41
51	73
94	113
128	149
156	175