CAZyme Information: MGYG000003177_01660

Basic Information

• Species: Amulumruptor sp900539915
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Amulumruptor; Amulumruptor sp900539915
• CAZyme ID: MGYG000003177_01660
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000003177_44|CGC1	39483.85	10.4813

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003177	2162791	MAG	United States	North America

• Gene Location: Start: 7570; End: 8643 Strand: +

Full Sequence      

MHIIISRFSAIGDVAMTIPVIYGLAKANPRHRFTMLTKRGMARIFVNPPRNLEIIGLDFK
GNPLSDWRTLAAAVDSVKDKARGKRYFVDLHDVLRSRLLAWVCRTRGFQTLRFDKARKAK
KQIISHKPGAEVSSNFIRYAAPFAKIPGLKPAAAFHSIFPGGRGDKKLFEHITGVRREGE
RWVGIAPFAAHEGKIYPQDLMKQVIDELAWKGSIRIFLLGGGKHEKEILDAWAAEYDNVT
SLAGSGLSLEAELSLMSHLDLMLTMDSANMHFSSLVGTPSLSIWGATSPVTGFAPYRSPD
SSTPNRYIQAEGLPCRPCSVFGNKPCRIGGYPCLRRITPGQVTERIIATLQGNDKAL

Enzyme Prediction     

No EC number prediction in MGYG000003177_01660.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	85	327	7e-32	0.9066666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.57e-35	2	346	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.16e-31	1	351	2	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	2.89e-13	183	331	108	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	5.02e-07	170	287	167	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD37124.1	3.33e-86	2	346	4	342
QUT74155.1	2.94e-85	2	346	3	339
QQR08225.1	1.36e-82	2	351	11	353
ANU64408.1	1.36e-82	2	351	11	353
ASB37493.1	1.36e-82	2	351	11	353

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999960	0.000110	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003177_01660.