CAZyme Information: MGYG000003178_02745

Basic Information

• Species: Klebsiella quasivariicola
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella; Klebsiella quasivariicola
• CAZyme ID: MGYG000003178_02745
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185		21176.09	10.3102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003178	3011876	MAG	United States	North America

• Gene Location: Start: 1813; End: 2370 Strand: +

Full Sequence      

MIRREALAQIGGFAVETVTEDAHTALKFQRLGWKSAFLDIPLAAGLATERLVVHVIQRTR
WARGMTQIFRLDNPLFGRGLTFQQRLCYLSAMLYYQFALPRVVFVTAPLAYLLFNLNIIY
SSASLIVSYALPHLFLAIYVGSRMNGRYRYSFWGEIYDIVLAFHLVLPTLVTMIFPKRGL
SLIHI

Enzyme Prediction     

EC	2.4.1.12

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11498	bcsA	3.70e-86	2	179	425	602	cellulose synthase catalytic subunit; Provisional
cd06421	CESA_CelA_like	2.72e-30	2	69	167	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	3.47e-16	1	175	220	400	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	1.19e-10	1	70	164	233	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
pfam03552	Cellulose_synt	3.71e-09	17	140	416	542	Cellulose synthase. Cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues, is the major component of wood and thus paper, and is synthesized by plants, most algae, some bacteria and fungi, and even some animals. The genes that synthesize cellulose in higher plants differ greatly from the well-characterized genes found in Acetobacter and Agrobacterium sp. More correctly designated as 'cellulose synthase catalytic subunits', plant cellulose synthase (CesA) proteins are integral membrane proteins, approximately 1,000 amino acids in length. There are a number of highly conserved residues, including several motifs shown to be necessary for processive glycosyltransferase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE58465.1	2.39e-122	1	179	56	234
APB51716.1	4.58e-119	1	179	291	469
BBE69995.1	4.58e-119	1	179	291	469
BBE64409.1	4.58e-119	1	179	291	469
AOF04332.1	4.58e-119	1	179	291	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	9.18e-63	1	179	437	615	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.73e-37	1	179	311	489	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.96e-37	1	179	323	501	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.97e-37	1	179	324	502	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0CW87	6.75e-69	1	179	313	491	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
Q76KJ8	6.75e-69	1	179	313	491	Cellulose synthase 1 OS=Komagataeibacter hansenii OX=436 GN=acsAB PE=1 SV=1
Q9WX61	4.15e-67	1	179	313	491	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
P19449	1.78e-66	1	179	313	491	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
O82859	2.54e-66	1	179	315	493	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
92	114
118	140
153	175