CAZyme Information: MGYG000003180_00640

Basic Information

• Species: Collinsella sp900544065
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900544065
• CAZyme ID: MGYG000003180_00640
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720	MGYG000003180_16|CGC1	78668.58	4.882

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003180	2090657	MAG	United States	North America

• Gene Location: Start: 6540; End: 8702 Strand: +

Full Sequence      

MSESIYTLRVSRAAAGAYPTISDALAAADQLYPVAEQPVMIRVDPGEYRERVEIHRSHVT
IEGETADSVRIVGSLCAKMPSEDGSGVDGTLGTFRTYTVLVDADDVRLENLTIVNDAGDG
REVGQAIALYADGDRLVVDACCITGRQDTLFLGPLPPREVKPGGFIGPKQFAPRRVGRQY
FRRCRIEGDVDFIFGGACAYFEGCEIRSLNRNMDVNGYVTAASTPEGEPYGFVFHGCSFT
AAQDVAPDSVYLGRPWREWAQTVLIDCWLGQHIKREGWWDWNKPAAHERACYAGAILHGP
AGDAAGWVPWARELDAAATARYAREQVLAGADGWGPEGGSGGAVETASLSDNGRTVHIDT
YYEDEPALRDRLKREGRSAAFKGATLGDFETWQVATRNRLCDLLGLSLMDRVPIEVRELD
RVQIAGGIVRTHAMLQVERDVWMPFYLLEPQAPKLDAHGRKRCYICPHGHQGAGAASVAG
VTGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDARGWGYRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVAGLNAWDNMRLIDYLEARGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYVPGLWRLLDMGDIASLIAPRPLLVQSCEGDHLN
GARGLANVDEQLDIVRGAYELVGHADDLLHEVCPGGHHLGVAHLAEDIEWLDERAAGVCS

Enzyme Prediction     

No EC number prediction in MGYG000003180_00640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	1.2e-79	0.9826388888888888
CE19	455	698	2.7e-25	0.6054216867469879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.78e-67	6	330	81	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	8.75e-50	16	311	10	275	Pectinesterase.
PLN02773	PLN02773	2.26e-45	8	314	7	282	pectinesterase
PLN02708	PLN02708	2.64e-40	10	323	245	538	Probable pectinesterase/pectinesterase inhibitor
PRK10531	PRK10531	2.94e-40	10	279	84	383	putative acyl-CoA thioester hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	716	1	716
ATP54718.1	0.0	1	716	1	716
QUC03567.1	0.0	8	715	7	709
QRP39805.1	6.37e-97	8	336	18	349
ASN95501.1	6.37e-97	8	336	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.07e-27	10	310	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	3.01e-25	33	289	55	311	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	7.00e-25	18	289	18	287	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	1.98e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.62e-24	16	278	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	8.52e-33	8	314	7	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	9.12e-31	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8L7Q7	5.11e-29	18	314	301	578	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2
O04887	5.72e-29	10	310	205	472	Pectinesterase 2 OS=Citrus sinensis OX=2711 GN=PECS-2.1 PE=2 SV=1
Q9LXD9	3.57e-28	18	314	251	527	Probable pectinesterase/pectinesterase inhibitor 51 OS=Arabidopsis thaliana OX=3702 GN=PME51 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003180_00640.