CAZyme Information: MGYG000003183_00019

Basic Information

• Species: Collinsella sp900541195
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900541195
• CAZyme ID: MGYG000003183_00019
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		57724.58	4.4464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003183	2113240	MAG	United States	North America

• Gene Location: Start: 23739; End: 25256 Strand: +

Full Sequence      

MVDSVVSQVYQNWELILVNASPECMELQKELGGLTDSRIKVITLEENKGIAENTNAGIAA
AVGDYVVFFDHDDTLDPFALYRYAERIQDRPDTDALYCDEDFLNEAGEYVSPHFKSDFNL
DLLRVHNYITHLLCVRASFAKELMLRKEFDGAQDYDFLLRLVERTQSIYHVREVLYHWRI
SDTSTAKSAGNKNYADEAGRKALQEHLDRCGLNGAAELTDSACFYHISYALNEEALVSIV
IPNKDSVEVLRRCIDSIEEKTDYRNFEILVIENNSTEDATFEYYRTVSEQYENVRIVTWN
GPFNYSAINNYGVGLTSGKYLLFLNNDTEVIEGGWLSSMLSFCQREDVGAVGAKLLYPDD
TVQHAGVMMIYCNNEGEMGGPIHVFNNLDRNDPGYMRRAVISQDLSAVTAACMMTKRSVF
EELNGFNEDFEVAFNDVDFCLRVRSLDKLVVFDADALLYHYESFSRGYETGEKKVRFMRE
QGKLRTAWAEYYVNGDPYHSPMSTR

Enzyme Prediction     

No EC number prediction in MGYG000003183_00019.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	238	423	3.9e-22	0.9882352941176471
GT2	2	98	2.7e-18	0.5764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.96e-75	1	180	20	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	4.68e-42	239	462	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	9.76e-24	237	479	5	238	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	1.58e-18	2	185	17	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.48e-18	238	420	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB07226.1	3.41e-223	1	504	290	794
AZH69456.1	5.54e-175	1	501	310	809
ATP53720.1	2.81e-172	1	504	310	812
QIB58022.1	1.66e-165	1	500	95	592
QMW77454.1	1.66e-165	1	500	95	592

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	4.82e-08	11	209	43	227	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5HEA_A	6.60e-08	236	332	6	99	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.53e-109	1	501	385	886	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.31e-92	4	504	341	832	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q4KXC9	5.17e-10	2	231	26	252	O-antigen biosynthesis glycosyltransferase WbnJ OS=Escherichia coli OX=562 GN=wbnJ PE=1 SV=1
Q54QG0	1.48e-06	2	98	35	136	Bifunctional glycosyltransferase pgtA OS=Dictyostelium discoideum OX=44689 GN=pgtA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003183_00019.