CAZyme Information: MGYG000003184_00253

Basic Information

• Species: Mixta calida
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Mixta; Mixta calida
• CAZyme ID: MGYG000003184_00253
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1225		137563.84	6.0606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003184	4133670	MAG	United States	North America

• Gene Location: Start: 279278; End: 282955 Strand: +

Full Sequence      

MKKILISADALDRFDEQSTYIVNMIDYLIRAGYQVELVTWRCSWKVQKALAEYRTAGQLR
LTLGEEEPAEASYDAALIFKGFFSAPLIARLEKNELQTHFIFHHFGYSRQSETELDARVE
NLLASTVFAFTPYAAQRLTDEGIMVDKLQTLPFLLPAVPKHSALRINKPQKVLSLTPKLD
KELRVACEQQGLELIWINSNELAVRVTAETVREYDLVMTSGYIATLTLSAGLPVFIADGE
HFYDYLGEHNYQDLHHYGFACLPNLPVLTAEQCAYQMKNAWLQAQQWVATQWQAPSVTEA
ISRLEAVLAQPLKSCPSVSEDALRQLSLHSKICIGNLQDNYNVHKWLQQRSPSSTRESIL
KSFLSSAAETSRIGVLILDAGEDVAALEQSLASLEEQRLQAHIICVADPTGYFQNLPLAQ
QINLLVFDNPTCINLLAESGALDWLVVMPAGWKLLPHALLTFAEYHLRAPQTRAFYCDEI
FYQNSEQQQVVLRPDCNIDLLRSFPYAGAVLSLDVSTINTVGGTQSNMQQLAHYDLVWKF
IEREGMQALASIPDVLVEAPMEFNHWKRQPALFAEAEQNLKHHYQRFSLPATVTGDKDKG
IFITHYPVNETDLVSVIIPSKNKAALLKNCIDNLADNTRWRNLEILIVDNGSDEADSQAY
LTQLKTLGLSSLRVLDYPGEFNYAAMINLAAAQAQGNYLLLLDNDCEVQQPEWLHTLMGI
AQRSEVGAVGPKLCFRDGRVQHGGYLTGIHQGIVNPFEFSSSTDMGYLHYLSATHNVSAL
SGSCLLTRTALFNELGGLDEASFAVFFADVDYCLKLKENGYVVTWTPNCEVVHMGGATLL
LSQEKAAIAMAKEEAQQALMDKWRQKLTLDNRYHPLMAKYGKPFTISEQMARIFPSLPGR
PLPRFMAAHSGWYGCGNHRVIQPYKALEENVFTEGGLYMGVPKVLEVAEMQPDTILLQLP
SGIGYPDLIKKYRRQCDARIIVEYDDYLPNLPVKNTLKHLFPQHIVKALRRVMAMADSVV
VSTQPLAEAYASFHHDIRVAHNRLAVSQWGSLMSQRRTGKKIRVGWAGGGTHAGDLEIIQ
PVIKALQDEVEWVFMGMKPEGIKCEFHTGVPFDLYPEKLASLNLDLALVPLEINHFNICK
SNLRLLEIGACGVPIIATRIEPYQCGLPVTLVDNRFKDWVSAIKMHLADMDATAKMGDAL
RAAVHQDWMLREHGLDEWRRAWLGE

Enzyme Prediction     

No EC number prediction in MGYG000003184_00253.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	615	795	2.2e-21	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	2.63e-34	616	835	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.81e-24	611	838	2	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	7.65e-19	615	792	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	8.56e-16	616	771	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd03794	GT4_WbuB-like	9.22e-16	951	1208	98	381	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU42125.1	0.0	1	1225	1	1225
QHM75122.1	0.0	1	1225	1	1119
QHM71455.1	0.0	1	1225	1	1118
QIE96195.1	0.0	1	1223	1	1228
AVY98558.1	0.0	1	1223	1	1209

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.88e-47	343	888	341	899	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	7.33e-40	443	838	403	797	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	3.85e-09	611	833	2	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	3.85e-09	611	833	2	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003184_00253.