CAZyme Information: MGYG000003184_00886

Basic Information

• Species: Mixta calida
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Mixta; Mixta calida
• CAZyme ID: MGYG000003184_00886
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
690	MGYG000003184_4|CGC2	78413.02	7.064

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003184	4133670	MAG	United States	North America

• Gene Location: Start: 145249; End: 147321 Strand: +

Full Sequence      

MDLTQLEKDASAAGIAASYINAKGEPEAISAETRQKLLEAMGFPRPVSDAPVPAVKVFSG
RRKRELAVGGSGPFRWTLQTEQGKTYQGEARGGETFPLPPRLPQGYHQLTLTQGENAWPC
RIIMAPRRCYEPQALLEGRKLWGACVQLYTLRSARNWGIGDFGDLSEMLTQIAERGGDFI
GLNPIHSLYPASPESASPYSPSSRRWMNVIYIDVERVPDFQQSEEAQRWWRDKETQRRIK
AARETEWVDYSAVNQLKIDGLWLAWAQFSTRDEQDATRRHFEAYIAAGGESLYSQAAYDA
LHAAMLKEDGQRWGWPAWPEKYRHAQSKAVQQFCRKNEDEVRFWLWLQWLANRQFDECWQ
VCQRHGMSVGLYRDLAVGVAEGGAETWSDPDLYCLKASVGAPPDILGPLGQNWGLPPMDP
HVMAARAYQPFIDMLRANMASCGALRIDHVMSMLRLWWIPYGQTADHGAYVYYPVDDLLA
ILALESHRNRCMVIGEDLGTVPKEIIGKLRSGGIYSWKVLYFEQESADRYRAPQEWQRQA
MASATTHDLPTLRGFWSAGDLTLGETLGLYPDKVVLKGLYENRERQKQALLDALHEQGCV
PKKLGKRAVKVPASAELSRGMQRYIAESASALLGLQPEDWLEMEKPVNVPGTVDQYPNWR
RKLSRTLEEMFNDEQINRLIKDLDKRRRAS

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	146	685	1.8e-162	0.9898785425101214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00217	malQ	0.0	127	685	1	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1640	MalQ	0.0	129	689	1	518	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK11052	malQ	0.0	1	689	1	691	4-alpha-glucanotransferase; Provisional
PRK14507	PRK14507	0.0	1	687	3	721	malto-oligosyltrehalose synthase.
pfam02446	Glyco_hydro_77	0.0	146	666	1	460	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUY23761.1	0.0	1	690	1	690
QNU43745.1	0.0	1	690	1	690
AIX75602.1	0.0	1	690	1	690
AUX91938.1	0.0	1	689	1	689
QHM73484.1	0.0	1	687	1	687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	0.0	1	686	1	686	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	0.0	5	686	5	686	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	7.13e-78	14	659	15	673	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15977	0.0	1	690	1	690	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	1.97e-169	62	676	70	686	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P65337	2.24e-95	14	673	16	703	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK22	2.24e-95	14	673	16	703	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P9WK23	2.24e-95	14	673	16	703	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003184_00886.