CAZyme Information: MGYG000003184_02532

Basic Information

• Species: Mixta calida
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Mixta; Mixta calida
• CAZyme ID: MGYG000003184_02532
• CAZy Family: AA6
• CAZyme Description: NAD(P)H dehydrogenase (quinone)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199	MGYG000003184_14|CGC2	21236.9	5.6138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003184	4133670	MAG	United States	North America

• Gene Location: Start: 107083; End: 107682 Strand: +

Full Sequence      

MAKILVLYYSMYGHVETMAKAVAEGVSKVEGAEVIVKRVPETMDAERFAQVGGKTDQDAP
EATPEELPQYDAIIFGTPTRFGNMSGQMRTFLDRTGGLWASGALYGKLASVFTSTGTGGG
QEHTISSTWTTLAHHGMVIVPIGYGTKELFDIGQVRGGTPYGASTYAGGDGSRQPSEEEL
NIARFQGEHVARLAVKLNG

Enzyme Prediction     

No EC number prediction in MGYG000003184_02532.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA6	3	195	8.6e-83	0.9897435897435898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK03767	PRK03767	1.08e-128	1	199	1	200	NAD(P)H:quinone oxidoreductase; Provisional
TIGR01755	flav_wrbA	1.64e-110	2	197	1	197	NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR (SP:P03032) are not detected. [Energy metabolism, Electron transport]
COG0655	WrbA	1.85e-58	1	197	3	205	Multimeric flavodoxin WrbA [Energy production and conversion].
COG0426	NorV	2.46e-14	2	194	247	387	Flavorubredoxin [Energy production and conversion].
pfam03358	FMN_red	7.66e-11	32	144	20	143	NADPH-dependent FMN reductase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOU22073.1	9.99e-64	1	196	1	198
CDM84515.1	4.23e-62	3	199	4	201
BAS94766.1	9.06e-62	3	199	4	201
CCA36908.1	2.28e-61	3	188	4	190
AOA60972.1	2.28e-61	3	188	4	190

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2R96_A	1.54e-116	1	199	1	198	Crystalstructure of E. coli WrbA in complex with FMN [Escherichia coli],2R96_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_A Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2R97_C Crystal structure of E. coli WrbA in complex with FMN [Escherichia coli],2RG1_A Crystal structure of E. coli WrbA apoprotein [Escherichia coli],2RG1_B Crystal structure of E. coli WrbA apoprotein [Escherichia coli],3B6I_A WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6I_B WrbA from Escherichia coli, native structure [Escherichia coli K-12],3B6J_A WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6J_B WrbA from Escherichia coli, NADH complex [Escherichia coli K-12],3B6K_A WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6K_B WrbA from Escherichia coli, Benzoquinone complex [Escherichia coli K-12],3B6M_A WrbA from Escherichia coli, second crystal form [Escherichia coli K-12],3B6M_B WrbA from Escherichia coli, second crystal form [Escherichia coli K-12]
4DY4_A	6.07e-116	2	199	1	197	Highresolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1],4DY4_C High resolution structure of E.coli WrbA with FMN [Escherichia coli APEC O1]
3ZHO_A	4.98e-115	2	199	1	197	X-raystructure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],3ZHO_B X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution [Escherichia coli],4YQE_A Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],4YQE_B Crystal structure of E. coli WrbA in complex with benzoquinone [Escherichia coli K-12],5F12_A WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12],5F12_B WrbA in complex with FMN under crystallization conditions of WrbA-FMN-BQ structure (4YQE) [Escherichia coli K-12]
4LA4_A	1.22e-68	3	197	4	203	Crystalstructure of native PnpB [Pseudomonas sp. WBC-3],4LA4_B Crystal structure of native PnpB [Pseudomonas sp. WBC-3],4LAF_A Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_B Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_C Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3],4LAF_D Crystal structure of PnpB complex with FMN [Pseudomonas sp. WBC-3]
5F4B_A	2.27e-65	1	199	4	202	Structureof B. abortus WrbA-related protein A (WrpA) [Brucella abortus 2308],5F4B_B Structure of B. abortus WrbA-related protein A (WrpA) [Brucella abortus 2308]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8AI59	1.25e-117	1	199	1	198	NAD(P)H dehydrogenase (quinone) OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=CKO_02047 PE=3 SV=1
B5XXP0	2.53e-117	1	199	1	198	NAD(P)H dehydrogenase (quinone) OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=KPK_3530 PE=3 SV=1
A4W916	4.19e-116	1	199	1	198	NAD(P)H dehydrogenase (quinone) OS=Enterobacter sp. (strain 638) OX=399742 GN=Ent638_1516 PE=3 SV=1
B5YU47	5.95e-116	1	199	1	198	NAD(P)H dehydrogenase (quinone) OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) OX=444450 GN=ECH74115_1242 PE=3 SV=1
B7LP27	5.95e-116	1	199	1	198	NAD(P)H dehydrogenase (quinone) OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=EFER_1155 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003184_02532.