CAZyme Information: MGYG000003184_03364

Basic Information

• Species: Mixta calida
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Mixta; Mixta calida
• CAZyme ID: MGYG000003184_03364
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
156		17405.05	8.9525

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003184	4133670	MAG	United States	North America

• Gene Location: Start: 42981; End: 43451 Strand: -

Full Sequence      

MSEVIKILKFEEGYRAKPYIDTEGFPTVAYGIKLGPRGCPISHYTFTVPEVVGSVWLETL
LSNNRLQMNSVPGIVDALRHCNEPRSDILYSMAWQMGVEGLAGFKNTLALISQENFAAAA
SSMLMSKWARQTPNRAKRHADVMRSGSYESYRGVII

Enzyme Prediction     

No EC number prediction in MGYG000003184_03364.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00735	T4-like_lys	1.45e-62	3	150	1	146	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
PHA02596	5	3.95e-24	6	156	177	340	baseplate hub subunit and tail lysozyme; Provisional
COG3772	RrrD	4.64e-06	2	129	9	127	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd00737	lyz_endolysin_autolysin	0.004	5	31	2	28	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIX73413.1	6.39e-112	1	156	1	156
AUY25658.1	6.39e-112	1	156	1	156
QNU45446.1	6.39e-112	1	156	1	156
AUX93785.1	5.05e-109	1	156	1	156
ARJ43385.1	8.39e-108	1	156	1	156

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1L73_A	3.67e-19	4	154	3	164	ChainA, LYSOZYME [Tequatrovirus T4]
1L75_A	1.02e-18	4	154	3	164	ChainA, LYSOZYME [Tequatrovirus T4]
1L72_A	1.02e-18	4	154	3	164	ChainA, LYSOZYME [Tequatrovirus T4]
191L_A	2.03e-18	4	154	3	164	ChainA, LYSOZYME [Tequatrovirus T4]
3C7Z_A	2.03e-18	4	154	3	164	ChainA, Lysozyme [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00720	1.97e-14	4	154	3	164	Endolysin OS=Enterobacteria phage T4 OX=10665 GN=E PE=1 SV=2
Q556F2	1.20e-13	1	152	2	170	Probable T4-type lysozyme 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274831 PE=3 SV=1
Q86AA1	1.33e-11	1	152	2	170	Probable T4-type lysozyme 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274291 PE=2 SV=1
P16009	1.49e-08	6	151	178	339	Pre-baseplate central spike protein Gp5 OS=Enterobacteria phage T4 OX=10665 GN=5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003184_03364.