CAZyme Information: MGYG000003185_00715

Basic Information

• Species: Peptococcus niger
• Lineage: Bacteria; Firmicutes_B; Peptococcia; Peptococcales; Peptococcaceae; Peptococcus; Peptococcus niger
• CAZyme ID: MGYG000003185_00715
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213	MGYG000003185_3|CGC1	23693.73	9.686

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003185	1766648	MAG	United States	North America

• Gene Location: Start: 169882; End: 170523 Strand: +

Full Sequence      

MVTTPSRRPRRGSKRAVSRNRRYRQRNAQVFKSRVFILLVFFALLALAIGLNVNQTRGAS
IEFTGNHEAYFEQMAPLAQKYGRKQGIYPSLILAQSALESGFGQSDLAKVHHNFFGIKRT
GQESSAAYQTEEVLGGESVTVTANFRAYDSVEDSVKDYAALVGTLPRYRGVVEADTPEEA
ARALVQGGYATDPAYAEKLIHMIETYDLKQYDG

Enzyme Prediction     

No EC number prediction in MGYG000003185_00715.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	74	208	1.1e-39	0.9921875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.06e-60	55	213	31	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	2.04e-44	65	211	150	300	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	1.79e-38	64	212	5	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	1.81e-35	49	203	130	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK08581	PRK08581	4.24e-34	58	212	309	472	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ34202.1	1.92e-38	66	212	35	180
QDJ59211.1	5.03e-37	60	213	55	211
QEA56504.1	5.03e-37	60	213	55	211
CDZ75698.1	1.03e-36	57	212	31	184
QPI47269.1	1.80e-36	29	212	25	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	1.62e-22	78	213	14	153	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	3.29e-22	68	210	2	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5DN4_A	3.29e-22	78	204	14	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
2ZYC_A	4.10e-22	68	210	3	151	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	3.14e-21	68	210	3	151	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.56e-25	33	212	14	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P58231	2.34e-23	65	204	147	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	2.34e-23	65	204	147	292	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
Q9CIT4	4.42e-22	53	213	48	215	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P15931	3.41e-21	64	204	149	295	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999453	0.000538	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
31	53