CAZyme Information: MGYG000003187_02037

Basic Information

• Species: Leclercia adecarboxylata_C
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Leclercia; Leclercia adecarboxylata_C
• CAZyme ID: MGYG000003187_02037
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1266		141987.3	6.0681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003187	4670976	MAG	United States	North America

• Gene Location: Start: 202409; End: 206209 Strand: -

Full Sequence      

MPIFSSFWQAGFEGADFVTRQGHALSMDHETGHDSRHYDDYRALRPFHIATVRESVGWRL
TDTSEGYDFTAVAAKMASAKENGIQICWTICHYGWPEDVDFFSEAFVTRFARLCGALAAF
LRPWYQEPPVYSPVNEISFTAWGIAVGLFPAALAEEMESMQIKRQLVRATIAACDAIWAA
DPRARILHCDPLIHLISPDDDPTTEQETEALRTAQYQAWDMLAGRHEPELGGNPRYLDLI
GANYYHDNQWMMGNNQRLAWHLGDRRRRRLHEMLQELYERYHRPILLAETSHVGSGRGAW
INDVASEVAQAQLAGVALSGICLYPIIDRPDWENCAVWHHCGLWDITPDKERHLNTLYAR
ALEQTQLRLKRFQQPSGAFTCTGTEVSDMKKIYVFSHLRWDFVFQRPQHLMTRLAQHYHI
VFIEEPLYSAEKPELKLSRPAPNVTVVQPHTPSTAAGFHDEQIAFLETLLTELREPDETP
VVWFYTPMALPLLKIFTPAIVVYDCMDELAAFEKAPRQLLQRESALLSRADIVFTGGPSL
YEARKGRHPNIHCFASSVDAVHFEQALDRANHHPLQDEIPHPRLGYYGVIDERMDLSLIA
ALADSHPEWQIVMVGPVVKIDPATLPRRSNIHYPGMQPYQALPQFLAGWDVCLMPFALNE
STRFISPTKVLEYMAAQLPVVSTAIADVEKPYSHVVAVAHDQADFIAACEQALALPEETR
KAQQQTMQGIVASTSWDKTVQSMHALIENAFLRYLDASAATVNAADSSSDESASEPVLRL
IPQKAARTEAQKCLILGAGPTGLSAAYHYGEGATLLERNATVGGLCRSIQDKGFTFDYAG
HIMFSADEEVLALYKTLLGDNIHWQIREAWVYTDGVYTRYPFQGSLYGLPATVVKECILG
AIEARYGAGSEVQNMTTCTEKSGQGKQHHDCCADGAVPDYISAESAEKTPRKGSFEAFIY
ETWGKGIARHFAIPYNKKLWTVPLSEMETSWLGGRVPLPDLEQIIDGALNETSKPMGPNA
RFGYPLQGGFQALMNGFLPHIKGRIETGAEVSKIYANQHIVALSDGRQYRYEHMISTLVL
PELIRLMGDEVPPDVRKAAKGLRHVSVRCVNLGVGRDNLTDKHWIYFAGKTIFHRIFVQG
NASPFCSPPGSCGLTCEISYSPDKPLPVDGQALIDRCIKECIEAGIISAEDEIITANQID
IPYAYVIYDQSRKENVETIRKWLLLHGITLAGRYSEWEYYNSDHAFIAGKVAVEKVRGSA
YRHSVS

Enzyme Prediction     

No EC number prediction in MGYG000003187_02037.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04950	GT4_TuaH-like	5.20e-119	392	749	7	371	teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK07208	PRK07208	4.12e-49	788	1265	2	466	hypothetical protein; Provisional
COG1232	HemY	3.12e-47	794	1257	4	443	Protoporphyrinogen oxidase [Coenzyme transport and metabolism].
PRK07233	PRK07233	3.47e-19	795	1125	4	295	hypothetical protein; Provisional
cd03801	GT4_PimA-like	8.64e-15	391	748	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDK20562.1	0.0	1	1266	1	1266
QGU15259.1	0.0	1	1266	1	1266
QIK13898.1	0.0	1	1266	1	1266
QGP83740.1	0.0	1	1266	1	1266
QFH65165.1	0.0	1	1266	1	1266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UTE_A	2.40e-43	794	1260	14	479	Crystalstructure of Aspergillus fumigatus UDP galactopyranose mutase sulfate complex [Aspergillus fumigatus],3UTE_B Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase sulfate complex [Aspergillus fumigatus],3UTE_C Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase sulfate complex [Aspergillus fumigatus],3UTE_D Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase sulfate complex [Aspergillus fumigatus],3UTF_A Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase in reduced state [Aspergillus fumigatus],3UTF_B Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase in reduced state [Aspergillus fumigatus],3UTF_C Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase in reduced state [Aspergillus fumigatus],3UTF_D Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase in reduced state [Aspergillus fumigatus],3UTG_A Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with UDP in reduced state [Aspergillus fumigatus],3UTG_B Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with UDP in reduced state [Aspergillus fumigatus],3UTG_C Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with UDP in reduced state [Aspergillus fumigatus],3UTG_D Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with UDP in reduced state [Aspergillus fumigatus],3UTH_A Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with substrate UDP-Galp in reduced state [Aspergillus fumigatus],3UTH_B Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with substrate UDP-Galp in reduced state [Aspergillus fumigatus],3UTH_C Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with substrate UDP-Galp in reduced state [Aspergillus fumigatus],3UTH_D Crystal structure of Aspergillus fumigatus UDP galactopyranose mutase complexed with substrate UDP-Galp in reduced state [Aspergillus fumigatus],4GDE_A Crystal structure of NADPH-reduced Aspergillus fumigatus UDP-galactopyranose [Aspergillus fumigatus],4GDE_B Crystal structure of NADPH-reduced Aspergillus fumigatus UDP-galactopyranose [Aspergillus fumigatus],4GDE_C Crystal structure of NADPH-reduced Aspergillus fumigatus UDP-galactopyranose [Aspergillus fumigatus],4GDE_D Crystal structure of NADPH-reduced Aspergillus fumigatus UDP-galactopyranose [Aspergillus fumigatus],5VWT_A Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADPH [Aspergillus fumigatus],5VWT_B Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADPH [Aspergillus fumigatus],5VWT_C Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADPH [Aspergillus fumigatus],5VWT_D Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADPH [Aspergillus fumigatus],5VWU_A Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADH [Aspergillus fumigatus],5VWU_B Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADH [Aspergillus fumigatus],5VWU_C Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADH [Aspergillus fumigatus],5VWU_D Crystal structure of oxidized Aspergillus fumigatus UDP-galactopyranose mutase complexed with NADH [Aspergillus fumigatus]
3UKL_A	1.36e-42	794	1260	10	475	Crystalstructure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_B Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_C Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_D Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_E Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_F Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_G Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus],3UKL_H Crystal structure of UDP-galactopyranose mutase from Aspergillus fumigatus in complex with UDP [Aspergillus fumigatus]
4U8K_A	1.43e-42	794	1260	14	479	Structureof Aspergillus fumigatus UDP-Galactopyranose mutase mutant Q107A [Aspergillus fumigatus],4U8K_B Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant Q107A [Aspergillus fumigatus],4U8K_C Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant Q107A [Aspergillus fumigatus],4U8K_D Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant Q107A [Aspergillus fumigatus]
3UKH_A	1.59e-42	794	1260	10	475	Crystalstructure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_B Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_C Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_D Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_E Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_F Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_G Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus],3UKH_H Crystal structure of udp-galactopyranose mutase from Aspergillus fumigatus in complex with UDPGALP (non-reduced) [Aspergillus fumigatus]
4U8L_A	2.60e-42	794	1260	14	479	Structureof Aspergillus fumigatus UDP-Galactopyranose mutase mutant N207A [Aspergillus fumigatus],4U8L_B Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant N207A [Aspergillus fumigatus],4U8L_C Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant N207A [Aspergillus fumigatus],4U8L_D Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant N207A [Aspergillus fumigatus],4U8O_A Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant N207A complexed with UDP [Aspergillus fumigatus],4U8O_B Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant N207A complexed with UDP [Aspergillus fumigatus],4U8O_C Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant N207A complexed with UDP [Aspergillus fumigatus],4U8O_D Structure of Aspergillus fumigatus UDP-Galactopyranose mutase mutant N207A complexed with UDP [Aspergillus fumigatus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000006	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003187_02037.