CAZyme Information: MGYG000003189_00040

Basic Information

• Species: Haemophilus_D parainfluenzae_M
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_M
• CAZyme ID: MGYG000003189_00040
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
186	MGYG000003189_1|CGC1	20631.79	9.2268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003189	2132219	MAG	United States	North America

• Gene Location: Start: 29858; End: 30418 Strand: +

Full Sequence      

MSKKFGAMILCSAAAVATAFFAQQKDLPAELQNKVSPQAVYMIVNLEGCVRNPYKCPADV
WTNGVGNTHNVDKSKVLTIDEVAADLRRNIKEAENCINADFNGREMNQGQYDAMVSLAFN
LGCGNIKRYYSKKHGMTLPTTIYRAAKAQDWTLMCNHISDFNKSGGRVLKGLQMRRTKEK
AICLGE

Enzyme Prediction     

No EC number prediction in MGYG000003189_00040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	35	179	3.1e-35	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16901	lyz_P1	1.01e-70	35	184	2	140	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd00737	lyz_endolysin_autolysin	6.62e-38	39	184	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	1.99e-28	60	176	1	106	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.
COG3772	RrrD	2.73e-27	32	185	4	149	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	1.97e-19	39	184	8	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQJ01970.1	5.27e-112	1	186	1	186
BBF14215.1	3.56e-110	1	186	1	186
BBF07083.1	3.56e-110	1	186	1	186
VEI55068.1	5.05e-110	1	186	1	186
BBF16032.1	5.05e-110	1	186	1	186

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XJU_A	2.59e-47	42	184	9	151	ChainA, Lysozyme [Punavirus P1],1XJU_B Chain B, Lysozyme [Punavirus P1]
1XJT_A	7.19e-43	42	184	37	179	ChainA, Lysozyme [Punavirus P1]
6ET6_A	5.42e-12	36	184	53	194	ChainA, Lysozyme [Acinetobacter baumannii]
3HDF_A	1.41e-06	46	184	9	136	ChainA, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]
3HDE_A	2.01e-06	46	184	34	161	ChainA, Lysozyme [Enterobacteria phage P21],3HDE_B Chain B, Lysozyme [Enterobacteria phage P21],3HDE_C Chain C, Lysozyme [Enterobacteria phage P21],3HDE_D Chain D, Lysozyme [Enterobacteria phage P21]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P51728	2.48e-111	1	186	1	186	SAR-endolysin OS=Haemophilus phage HP1 (strain HP1c1) OX=1289570 GN=lys PE=3 SV=1
Q37875	2.76e-46	42	184	37	179	SAR-endolysin OS=Escherichia phage P1 OX=2886926 GN=17 PE=1 SV=1
Q9T1T5	1.74e-10	35	182	3	142	Endolysin OS=Acyrthosiphon pisum secondary endosymbiont phage 1 OX=2682836 GN=13 PE=3 SV=1
Q37896	3.09e-07	35	184	3	143	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
P27359	4.23e-06	46	184	34	161	SAR-endolysin OS=Enterobacteria phage P21 OX=10711 GN=R PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006451	0.992541	0.000290	0.000265	0.000213	0.000214

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003189_00040.