CAZyme Information: MGYG000003189_00347

Basic Information

• Species: Haemophilus_D parainfluenzae_M
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_D; Haemophilus_D parainfluenzae_M
• CAZyme ID: MGYG000003189_00347
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
197	MGYG000003189_3|CGC1	22453.7	9.6346

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003189	2132219	MAG	United States	North America

• Gene Location: Start: 100781; End: 101374 Strand: -

Full Sequence      

MTMIIPETTFNKVFPKAIKGVYQAISKHIELAGCFNKQQQAMFLAQCGHETAGFTTLSEN
LNYSADGLMKVFRKYFPDSNIARQYERKPEKIASRVYANRMGNGPEETMDGWNYRGRGLI
QITGKDNYIRFARWLGDTISPKEVSSNLDLAVKAAVWYWIFNDLASIDSVQKVTIRINGG
TNGLDDRYRLFRALMVD

Enzyme Prediction     

No EC number prediction in MGYG000003189_00347.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	35	161	1.6e-30	0.43722943722943725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	1.32e-76	2	196	1	202	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	2.21e-10	5	180	1	189	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	5.36e-08	36	160	49	155	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE92742.1	1.68e-98	1	196	1	196
BBF07642.1	1.68e-98	1	196	1	196
BBF10945.1	1.68e-98	1	196	1	196
VTP75545.1	2.38e-98	1	196	1	196
QEQ61225.1	2.38e-98	1	196	1	196

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	6.70e-30	33	193	47	217	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	9.14e-97	1	196	1	196	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	4.96e-15	32	196	210	359	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003189_00347.