CAZyme Information: MGYG000003192_00316

Basic Information

• Species: UBA5416 sp900539175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA5416; UBA5416 sp900539175
• CAZyme ID: MGYG000003192_00316
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	MGYG000003192_4|CGC3	27159.99	7.001

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003192	4033193	MAG	United States	North America

• Gene Location: Start: 58312; End: 59022 Strand: +

Full Sequence      

MIPKVIHYCWFGRGEKSPLAKKCIESWHKYCPDFEIIEWNEDNFDIVAYPYAQYCYENKK
YAFLSDFIRLIVINRHGGIYFDTDVEVVKPLESLLECEAFYGFENSSNVNTGQGFGAEAG
HITVQALLQEYLKIEPDSQGNYTLAACPKLNTQALLSLGLELNGMRQTVAGAAILPVEYL
NPYDDPTGRLRKTDQTFSIHWYSKSWIGKGEVIRSKITKPFHRLFGTDCFRSLRRR

Enzyme Prediction     

No EC number prediction in MGYG000003192_00316.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	96	9e-25	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.19e-19	1	121	81	204	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	4.58e-18	21	101	5	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.51e-13	1	133	45	193	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUA54400.1	1.17e-105	1	236	1	236
ANU77720.1	3.05e-95	1	231	1	228
QJU16510.1	3.05e-95	1	231	1	228
ASU30521.1	3.05e-95	1	231	1	228
QQQ95316.1	3.05e-95	1	231	1	228

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003192_00316.