CAZyme Information: MGYG000003192_00479

Basic Information

• Species: UBA5416 sp900539175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA5416; UBA5416 sp900539175
• CAZyme ID: MGYG000003192_00479
• CAZy Family: GH36
• CAZyme Description: Bifunctional alpha-galactosidase/sucrose kinase AgaSK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000003192_6|CGC1	83305.67	4.9361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003192	4033193	MAG	United States	North America

• Gene Location: Start: 66443; End: 68638 Strand: +

Full Sequence      

MAIVLNEKKDLFTLQTDHTMYQMKVDDCGVLLHTYYGKKTSVCDYSYLITYADRGFSGNP
YEKEDDRTYTLDALPQEYPSYGSGDYRTSALKVRYPNGSNACELRYAGYEIRPGKYSIPG
LPAIYATEDTKAETLILRLEDTTRQILVSLYYGVLENLDMITRSVTVQNTGESPLYLERV
LSTCLDFQQAGYELQTFYGRHVKERTPQRALLQHGVWTIGSTRGASSHQHNPFFILCGQD
TTEDVGSCYGCSFLYSGDFLGAAEVDQFDQTRVVMGIHPENFCFQLEPDQIFHAPEAAMV
YSEAGFATLSHRYHNAYRNNLCRGKFRKTRRPVLLNSWEGVYFDFDGDKLVRMAKEAAEL
GVELFVMDDGWFGKRDDDKSGLGDWAVNEKKLGCTLAELSERIHEFGMKFGIWFEPECIS
EDSDLYREHPDWALQVPGKRPVRSRSQLVLDFSRKEVREHVFEQMCEVLDQTKIEYLKWD
FNRSISDIYSIVLPKERQGEVAYRYVLGLYEILERLGKRYPDMLIEGCSGGGGRFDAGML
YYTPQIWCSDDTDAIERLTIQYGTSFAYPVSTMGAHVSQCPNEQTGRNTPFETRAAVAMA
GTFGYELDVNQMSAEEKEAVRSQIQEFKNDYDLIQYGSYYRLTDPNHNGGHHAWEFVSED
QREALVCAVALQIHPNGPAAILKFKGLKEDAIYEMNGGKYPGGALMEAGIPVPRANVEYE
SFRFHAVMVEK

Enzyme Prediction     

No EC number prediction in MGYG000003192_00479.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	11	711	8.9e-269	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3345	GalA	0.0	10	710	2	665	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	0.0	292	637	2	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14791	GH36	6.57e-145	330	628	1	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16875	Glyco_hydro_36N	5.23e-114	29	287	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
pfam16874	Glyco_hydro_36C	2.47e-18	651	725	1	77	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW81127.1	0.0	1	727	1	727
QIB56139.1	0.0	1	727	1	727
QBE96096.1	0.0	1	727	1	727
QJU16478.1	0.0	1	727	1	727
ASU30552.1	0.0	1	727	1	727

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	5.69e-298	1	724	1	715	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
4FNQ_A	9.33e-231	1	731	1	729	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	9.79e-228	1	731	1	729	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2XN0_A	4.96e-226	3	727	6	731	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
4FNU_A	8.99e-226	1	731	1	729	Crystalstructure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	5.44e-294	1	724	1	715	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q9ALJ4	5.36e-227	1	731	1	729	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
G1UB44	2.72e-225	3	727	6	731	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	4.73e-221	3	725	4	726	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
P27756	4.03e-171	1	727	1	718	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003192_00479.