CAZyme Information: MGYG000003192_01647

Basic Information

• Species: UBA5416 sp900539175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA5416; UBA5416 sp900539175
• CAZyme ID: MGYG000003192_01647
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		34854.53	5.0063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003192	4033193	MAG	United States	North America

• Gene Location: Start: 3273; End: 4178 Strand: +

Full Sequence      

MLYLEFKKETFKKNVKENVKNLYRRTLEEATPQQIFQAVSYTVKDVIIDNWMKTQERITQ
NDPKVVYYLSMEFLMGRALGNNLINLTAYKEVKEALDELGLDLNLIEDQEPDAALGNGGL
GRLAACFLDSLATLGYPAYGCGIRYRYGMFKQQIKDGYQVEVPDNWLRDGNPFELRRPEY
AKEVKFGGYVRVQYNEKTGRNDFIQEGYQSVRAVPYDMPIVGYNNEMVNTLRIWDAEAIN
DFQLDSFDKGDYHKAVEQENLARTIVEVLYPNDNHLAGKELRLKQQYFFISASLQTAVAK
Y

Enzyme Prediction     

EC	2.4.1.1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04300	GT35_Glycogen_Phosphorylase	3.92e-166	12	301	1	288	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02093	P_ylase	2.11e-144	15	301	1	285	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam00343	Phosphorylase	3.48e-132	96	301	1	204	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
COG0058	GlgP	3.90e-94	7	295	5	250	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14986	PRK14986	2.54e-85	30	295	36	295	glycogen phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOV19349.1	7.46e-192	1	301	1	301
QNM07938.1	6.63e-180	1	301	1	302
AWY99285.1	4.85e-177	1	301	1	301
CBL22715.1	1.04e-175	1	301	1	301
ASM70669.1	1.10e-175	1	301	1	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5IKO_A	1.10e-89	30	301	50	315	Crystalstructure of human brain glycogen phosphorylase [Homo sapiens],5IKP_A Crystal structure of human brain glycogen phosphorylase bound to AMP [Homo sapiens]
7P7D_A	6.52e-88	12	301	22	305	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
5OX0_A	8.18e-88	12	301	29	312	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
3CEH_A	8.78e-88	30	301	24	289	Humanliver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
1Z8D_A	1.12e-87	12	301	29	312	ChainA, Glycogen phosphorylase, muscle form [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P53534	1.36e-89	30	301	47	312	Glycogen phosphorylase, brain form (Fragment) OS=Rattus norvegicus OX=10116 GN=Pygb PE=1 SV=3
Q0VCM4	3.35e-89	30	301	47	312	Glycogen phosphorylase, liver form OS=Bos taurus OX=9913 GN=PYGL PE=2 SV=1
Q5MIB5	4.68e-89	30	301	47	312	Glycogen phosphorylase, liver form OS=Ovis aries OX=9940 GN=PYGL PE=2 SV=3
P11216	5.69e-89	30	301	47	312	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5
Q8CI94	7.97e-89	30	301	47	312	Glycogen phosphorylase, brain form OS=Mus musculus OX=10090 GN=Pygb PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003192_01647.