CAZyme Information: MGYG000003193_01207

Basic Information

• Species: CAG-831 sp900544175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900544175
• CAZyme ID: MGYG000003193_01207
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000003193_13|CGC2	39986.49	10.3708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003193	2486830	MAG	United States	North America

• Gene Location: Start: 17919; End: 18986 Strand: +

Full Sequence      

MMAGTSRRTNTLLVIRMSALGDVAMTVPVIYSFARQYPDWHIKVLTQPFFSRLFLDKPDN
VSFIMADPKGRHKGPAGLFRLIRDTHKEHVTAVADMHNVLRSWAVDISFILTGKKVRIVR
KKRRERKRLTSLRHKRLVRQRNFIDRYFDVLSSLGLPASRQFSSLFPDSTPSENDVPHIG
IAPFARYTTKTYPPEMMEKAAAMLAGKGYRVLLFGGKGNEAEELEKWESAHPGIKSVAGK
LTIDKELELMSRLDLMVSMDSANMHLSSLAGTRVISVWGGTTVHCGFLGWRQKEEDAICA
GLQCQPCSIAGKPECPLGHMNCLRSISPEEICNKITETIHQRNSRPLAQQPFGIR

Enzyme Prediction     

No EC number prediction in MGYG000003193_01207.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	80	321	1.1e-35	0.9733333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.69e-50	11	337	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	9.65e-40	12	331	4	322	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	8.71e-21	79	319	2	245	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	1.06e-16	177	331	175	325	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	1.57e-08	12	298	8	304	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43584.1	8.84e-100	9	339	3	332
QUB41015.1	1.47e-88	6	345	3	337
QUB92002.1	1.10e-87	8	335	2	344
QUB58656.1	1.37e-86	8	337	2	346
QUB56061.1	1.37e-86	8	337	2	346

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34