CAZyme Information: MGYG000003193_01531

Basic Information

• Species: CAG-831 sp900544175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; CAG-831; CAG-831 sp900544175
• CAZyme ID: MGYG000003193_01531
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662	MGYG000003193_19|CGC1	73818.59	5.3205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003193	2486830	MAG	United States	North America

• Gene Location: Start: 25954; End: 27942 Strand: +

Full Sequence      

MSVKNFLRITAVILTCRAGLCPAVPLPLRAEETPHTHNIIPRPVSVRFTAGCFDLQKAVI
GDNVKVRISASYGPAESYFLHVTPDSVVIEAADSAGLFYAGNTLRSLHDTATGSIPCVEV
RDTPRFRWRGFMQDVSRHFFSIDYLKRQIDAMASLKLNVLHLHLTDAAGWRVQIDRYPLL
TSMAAWRDGALWKDWWFGDRRYLAEGSPGAYGGYYTKEELKDLVKYASERHVTIVPEIEM
PSHSDEVLAAYPELSCTGEPYKHPDFCIGKEETFEFLENVLTEIMDIFPSPYIHIGGDEA
SKQAWKECPACQARMKELGLENVDELQSYMIGRIGTFLESHGRIPVGWDEILQGGADSSA
VVMAWRSVDEGIKSARSGHRTVMSPGAFCYFDTYQDDPSTLPTAMGGYLPLSKVYGFNPV
PEGLDTEAASNIIGVQANLWAEYIPEERHAELMIYPRLYALAEVAWSPEEGKDYGDFRRR
ALIMCSKMSKAGYNVFDLAHETGDRPASTRPVAHKATGCKVIYNAPYNQTYSAGGDSALT
DGQHGGWTYSDGRWQGFISRNRLDVTVDLGKSQDISSVMLDFMQVCGPEVFLPAEVVISA
SEDGKDFMELSRTGREVIRDDKVTFVTDGWRAASPVKARYIRVQARSGQYGGWIFTDEIV
VL

Enzyme Prediction     

No EC number prediction in MGYG000003193_01531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	121	468	4e-118	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	126	481	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.48e-155	126	468	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	1.28e-111	75	480	205	627	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	8.04e-103	126	480	1	328	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06570	GH20_chitobiase-like_1	5.88e-88	126	480	1	310	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK86217.1	1.09e-256	75	661	96	680
QEW35778.1	1.21e-256	75	661	99	683
QJR77756.1	1.21e-256	31	661	21	683
AND21639.1	1.21e-256	31	661	21	683
QQY43262.1	1.21e-256	75	661	99	683

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	1.50e-139	53	661	82	773	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7CBN_A	3.64e-97	55	480	56	495	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
3RCN_A	1.24e-95	75	480	77	497	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
7DUP_A	5.68e-83	74	480	77	505	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	3.05e-82	74	480	77	505	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	1.07e-111	76	494	111	531	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	2.70e-96	55	480	75	514	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
B2UP57	3.36e-71	76	507	58	486	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
P96155	9.96e-67	77	462	209	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
Q7WUL4	2.07e-57	42	493	54	475	Beta-N-acetylhexosaminidase OS=Cellulomonas fimi OX=1708 GN=hex20 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003221	0.994211	0.001815	0.000312	0.000226	0.000200

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003193_01531.