CAZyme Information: MGYG000003194_01410

Basic Information

• Species: Paramuribaculum sp900546365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900546365
• CAZyme ID: MGYG000003194_01410
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
496		55839.21	4.7567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003194	2001061	MAG	United States	North America

• Gene Location: Start: 55076; End: 56566 Strand: +

Full Sequence      

MACMASLCASAQGLELREQHFELPDNEPAPCFPLPSDRQLKWHDMEFYAFFHYGMNTYTD
KEWGYGDEDPSTFAPTKAPNPRQWLEACKEAGMKGGIAVVKHHDGFCLWPTATTTHNCTS
SSSKYAKATNIPRDFAKAARELDMKYGFYVSPWDRNSALYGTDKYVSDVFMKQCDELAKF
GSDQFEMWFDGANGGDGYYGGANETRSVDASTYYDIPNLRDWVHSIAPDCVMWGVGEEAR
WIGNESGFAGETDWCMIDRGHPSEESSRNCGQENGWIWLPGESDAKATDSGWFWHPTQKE
LTAERLFQMYLETVGRNANLILNVPPDRSGYLPESSVAMLREMGKMLRTRLGNDLAPSAV
RIDASNTRANGANRTYDARNMIDGDPDSYWAPEDDVTASEITLQWDKPQPLRYVTLQEYI
AKGQRVKGFRIETSMDGEHWTVQAPQVAQTTVGYKRIIPLNGSTAQSYTDPVMAKYLRVS
VTDSRACPLINNISVY

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	36	348	2.6e-60	0.8641618497109826
CBM32	365	483	4.6e-17	0.8306451612903226

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	1.97e-42	33	496	9	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	3.34e-30	38	348	48	329	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	3.93e-27	52	348	50	331	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	1.84e-13	362	484	2	115	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam13163	DUF3999	5.70e-04	354	496	77	204	Protein of unknown function (DUF3999). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 440 and 470 amino acids in length. There is a single completely conserved residue D that may be functionally important.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI56213.1	8.04e-227	14	496	29	509
QUB82373.1	1.32e-225	14	496	29	509
QUB66849.1	5.16e-225	1	496	13	508
QUB79996.1	2.17e-224	25	496	40	509
QUB69927.1	1.71e-223	1	496	13	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	9.77e-95	30	496	34	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3UES_A	2.95e-78	35	491	19	471	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	3.44e-76	35	491	19	471	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	4.20e-74	35	491	21	473	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
4ZRX_A	2.64e-65	34	496	31	458	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.14e-73	28	496	31	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.50e-73	24	496	29	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P49713	3.28e-10	24	347	20	342	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q99LJ1	3.50e-07	12	348	14	349	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
Q9VTJ4	6.57e-07	80	348	113	361	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998023	0.002005	0.000003	0.000002	0.000002	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003194_01410.