CAZyme Information: MGYG000003195_01171

Basic Information

• Species: Anaerococcus sp900541365
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus sp900541365
• CAZyme ID: MGYG000003195_01171
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218		24853.14	4.4485

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003195	1676978	MAG	United States	North America

• Gene Location: Start: 469; End: 1125 Strand: -

Full Sequence      

MKVLKFIGKLIGYILLTILLAIALSYGIIAYQTSRTRINYQDQITEISDEANVDPLLTAA
IVKVESDFDNDAHSHQGAQGLMQLLDDTARHSAEVIDMDYYPEKLNDIDYNLKLGVGYYD
YLMKYYNNRKLALAAYNGGVGNVDKWIKEGVLDKENPDISKIPFEETRQYVTKVESTYDV
YKTFYKDGLPTNSELSDIGQLSYNNFMTFISELLYNIA

Enzyme Prediction     

No EC number prediction in MGYG000003195_01171.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	46	180	7.4e-28	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.66e-58	38	180	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.08e-42	40	182	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.66e-33	55	178	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.68e-29	25	185	124	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
PRK11619	PRK11619	6.59e-23	40	194	479	639	lytic murein transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV29351.1	7.42e-107	1	217	1	217
QQN55587.1	6.84e-84	1	217	1	217
QQB62557.1	1.59e-82	1	217	1	217
QQK07141.1	1.36e-41	1	216	1	212
BAG07763.1	7.65e-41	5	187	2	184

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	1.65e-15	40	200	453	616	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5MPQ_A	2.18e-15	40	185	416	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.19e-15	40	185	420	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.20e-15	40	185	426	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.20e-15	40	185	430	573	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	2.28e-14	40	200	480	643	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.28e-14	40	200	480	643	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	4.18e-14	40	194	480	640	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	3.19e-12	44	178	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P44888	7.04e-12	40	181	428	571	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.973517	0.013241	0.001189	0.000084	0.000049	0.011943

TMHMM  Annotations     

start	end
10	29