CAZyme Information: MGYG000003196_00911

Basic Information

• Species: Corynebacterium sp900539985
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium sp900539985
• CAZyme ID: MGYG000003196_00911
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		48934.07	8.2363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003196	2252984	MAG	United States	North America

• Gene Location: Start: 28838; End: 30151 Strand: +

Full Sequence      

MRTRLPADRIKCTAMKLARTPLFRYVLALLGLIFGAWKVVQDTRITDFPIDMVVYREGVK
AFLEHRSVYSEPMLAGDIELPFIYPPFGALVMVPLTAFDGIDHDMAGDIMVVLSDLLLLV
CLYFVFKAVLKKPDFLLPITAIAWAIALRFEPVDLNNGFAQINIVVMALVILDLVPRKRF
LPQGILIGLAAAIKITPLAMLLYFLVRKEWKQIATAFLSAVGATLLAAAFRWDAFVEFFS
SKLLDMGSGGDFGVATEYQSNSSIKGAIQRMYSSTEAMDANGLTINLAWLAASLVVIAFA
AWLIKRLCEEHLLVDAQLVTALTLLLISPVSWSHHWVWLTLIIPVFVYRAWTWLPSGWAA
GSLLTVLIAWAAMVLTVPPKWWWGDQVDVHTMERYQKFWVDDFVWLTILTVALYVAAFYA
TQRNRRTGTATPAPLAS

Enzyme Prediction     

No EC number prediction in MGYG000003196_00911.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	82	329	2e-56	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09594	GT87	7.70e-26	82	329	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.
PRK13375	pimE	1.35e-22	50	377	45	349	mannosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ66704.1	5.97e-295	15	437	1	423
QQU81598.1	1.40e-291	15	437	1	424
QQA99857.1	7.54e-280	15	437	1	424
QQN47003.1	6.58e-274	15	437	1	424
VEH72753.1	2.65e-259	15	437	1	423

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ8	7.87e-38	25	437	23	427	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	7.87e-38	25	437	23	427	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R036	3.45e-36	26	366	26	374	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
P9WN00	9.93e-20	50	377	69	374	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1
P9WN01	9.93e-20	50	377	69	374	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999947	0.000071	0.000007	0.000000	0.000000	0.000009

TMHMM  Annotations     

start	end
21	40
109	126
155	174
184	206
213	235
282	304
311	330
334	351
356	378
398	420