CAZyme Information: MGYG000003197_00404

Basic Information

• Species: F0422 sp003999875
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; F0422; F0422 sp003999875
• CAZyme ID: MGYG000003197_00404
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		61505.47	8.7707

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003197	1901086	MAG	United States	North America

• Gene Location: Start: 38214; End: 39821 Strand: +

Full Sequence      

MEQTFSWKRFAWLGMGTFLFYLFMAWALPVTDTVESNYALSAVTMMKHGEFLSPMIYDMY
WYDKPIMAYWGLILSYSLFGISDLAARLPSIVVSTCAVLAMYRMAFSIYQVERVAMWSAI
ALGTALEFWYIGHAVVTDGYLFLFSMGIFYYVYRGITGESHRHMIYAYIFAGLAVLTKGP
VGIVLPGIILILYVALNRRMDWFKYVFSWKGILAFILVVAPWYGYMYHVHGDAFIHGFLG
LHNVTRATVPEHPEHNWWYLYFALLPICIMPWTSFVVRGINEQKHAYIWYWSIFWLVGTV
LFYTCMATKYITYTFIMLIPLALWAGMGIHVCIEGYKERKMTWKVFILYALGGVPFLLGL
VIAGLSMSLSHSAYLWISLAVTVVSCIYAASKRTGHVLVCSMATSAIVFYLALVPNLVPI
MEDQSGKVLANEVMALEGATPLDVYQYGNYRTSLSYYLGRTTSYIHYKEHESVWEDGKNI
MPMVKPTELAKDREKLSRALIYVPNKYTTYFKETSIYNQVQPVEKDSRGVFYKAK

Enzyme Prediction     

No EC number prediction in MGYG000003197_00404.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	497	1.9e-83	0.9462962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	7.05e-38	1	365	1	372	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.24e-17	63	222	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	1.22e-11	35	374	33	377	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	9.36e-07	26	227	23	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV73216.1	2.05e-104	9	535	8	538
BBU36964.1	4.08e-104	9	533	8	536
VEG94157.1	1.14e-103	9	533	8	536
QQB17357.1	6.24e-102	9	533	8	544
SNV00837.1	6.24e-102	9	533	8	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.33e-09	35	274	59	301	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KGY4	3.51e-18	20	374	15	372	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
O67601	1.05e-16	13	248	8	228	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A4SQX1	1.88e-16	19	374	14	372	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
Q6D2F3	1.05e-15	35	369	35	372	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
Q02R27	1.37e-15	35	326	32	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
9	31
85	107
128	150
165	196
205	227
258	280
287	306
311	333
345	367
372	391
398	420