CAZyme Information: MGYG000003198_00096

Basic Information

• Species: Paramuribaculum sp900759835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900759835
• CAZyme ID: MGYG000003198_00096
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	MGYG000003198_6|CGC1	48161.76	9.4123

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003198	2857950	MAG	United States	North America

• Gene Location: Start: 9656; End: 10927 Strand: -

Full Sequence      

MNIIYNTAISAVNAALKTYARFLPKTPRYKFQEFVKGRVGLIRRVYQEMANDDKSLPVVW
FHASSLGEYAIARPLIARLKAKRKVRIVMTFFSPSGYRVVSKNHQDIDHVFYLPLDTILN
TSNFVKAVNPAAAVFLVSEYWPNMLQTLKFKAIPTFLVSAKIRSDAPFFKWYGKIYRDAL
STYKHFFVLDEDSRFNLKMLGWDNMTVSGDPLFDNASLMARTEWSDPVIERFIADGRPVF
MAGSVSEKNDIALVAETVNRHPQIRSIIVPHDIGRRQIEAIQQSLERKAVLYSQVTENTD
FSQIDTLIIDSVGKLAYLYRYATMAYVGGGFTPLLHSVIEATVYGVPVSFGPCIERKITP
QQMIELGIGQMVRTPEELSSWVDKFTPGLLAEIKEKCAEYVERNLGATPKIVNMIEHYVW
PTE

Enzyme Prediction     

No EC number prediction in MGYG000003198_00096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	53	214	3.3e-38	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1519	KdtA	3.55e-51	25	419	26	419	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
PRK05749	PRK05749	8.62e-51	57	419	51	421	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
pfam04413	Glycos_transf_N	1.86e-38	57	214	14	175	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43580.1	2.76e-123	4	415	4	417
QUB41467.1	4.66e-103	37	416	2	382
QGA23522.1	1.83e-79	1	415	1	407
BBL05955.1	7.25e-79	4	415	3	406
APA00941.1	9.94e-79	1	415	1	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	5.92e-17	59	405	43	359	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
F0T4D1	1.36e-23	22	369	22	377	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydophila psittaci (strain ATCC VR-125 / 6BC) OX=331636 GN=waaA PE=1 SV=1
Q3KMF4	5.22e-19	57	354	56	359	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) OX=315277 GN=waaA PE=3 SV=1
Q9PKI5	9.40e-19	57	417	55	416	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=waaA PE=3 SV=1
P0CE14	1.27e-18	57	354	56	359	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=waaA PE=3 SV=1
Q8R6G8	2.43e-18	31	377	13	367	Bifunctional glycosyltransferase/methyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355) OX=190304 GN=trmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003198_00096.