CAZyme Information: MGYG000003198_01608

Basic Information

• Species: Paramuribaculum sp900759835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900759835
• CAZyme ID: MGYG000003198_01608
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		51808.82	4.4883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003198	2857950	MAG	United States	North America

• Gene Location: Start: 2421; End: 3842 Strand: +

Full Sequence      

MNYSNLLKRSFLIAIVALATTGCQEDVNIGNVQAPDVTGSGDAMLYVADANGSTGHSSLE
FRSTADLDFYVNTTAANQVSENVTFAYDPSVLEQYNKANNTEFEAVPASMVTLSNGGSAT
LAVGETQSAPVTLTLTSDGSLDAETTYAVPLRVSSTGNLASMSQNRIVFVKDLTSIPDCH
KTWTDANGEVHEGIKIFSCMEVNDTNPLNNLSFTLKKSGKYLIDAVILFSANINYDSKSG
RVYVYCNPNVQHLLDNREKYLKPLQDRGMKVILGILGNHDRAAIDNLADETARLFAQECK
GLIDAYNLDGVFLDDEYSATISPAPAGFVEPSRDAASRLCYELDRAMPDKLVVVYVLGGT
YKLNPVDGKQPGEYIDYGLHDYGQHSDLESHYPGLPKSGMGMYSQEFARANWAEISELRS
MRNNGYGAHMIFAMDPNRGNTNVQRQLNALQNCASAFYDDDMVFDGIKYPKDW

Enzyme Prediction     

No EC number prediction in MGYG000003198_01608.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06542	GH18_EndoS-like	4.56e-43	221	444	26	248	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
pfam08522	DUF1735	1.13e-16	45	158	5	118	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam00704	Glyco_hydro_18	9.59e-06	221	317	21	114	Glycosyl hydrolases family 18.
cd00598	GH18_chitinase-like	1.39e-04	222	435	23	208	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS96497.1	1.43e-152	12	473	11	469
QQT26426.1	2.02e-152	12	473	11	469
QQR08218.1	2.45e-134	5	473	4	487
ANU64416.1	2.45e-134	5	473	4	487
ASB37485.1	2.45e-134	5	473	4	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EBN_A	1.68e-109	188	473	4	289	CRYSTALSTRUCTURE OF ENDO-BETA-N-ACETYLGLUCOSAMINIDASE F1, AN ALPHA(SLASH)BETA-BARREL ENZYME ADAPTED FOR A COMPLEX SUBSTRATE [Elizabethkingia meningoseptica]
6T8I_A	6.70e-72	25	471	2	439	Crystalstructure of wild type EndoBT-3987 from Bacteroides thetaiotamicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],6T8K_A Crystal structure of Bacteroides thetaiotamicron EndoBT-3987 in complex with Man9GlcNAc product in P1 [Bacteroides thetaiotaomicron VPI-5482],6T8K_B Crystal structure of Bacteroides thetaiotamicron EndoBT-3987 in complex with Man9GlcNAc product in P1 [Bacteroides thetaiotaomicron VPI-5482],6T8L_A Crystal structure of Bacteroides thetaiotamicron EndoBT-3987 with Man9GlcNAc product in P212121 [Bacteroides thetaiotaomicron VPI-5482],6TCW_A Crystal structure of Bacteroides thetaiotamicron EndoBT-3987 with Man5GlcNAc product [Bacteroides thetaiotaomicron VPI-5482],7NWF_A Chain A, Endo-beta-N-acetylglucosaminidase F1 [Bacteroides thetaiotaomicron VPI-5482]
6TCV_B	1.53e-69	25	471	2	439	Crystalstructure of Bacteroides thetaiotamicron EndoBT-3987 in complex with Man9GlcNAc2Asn substrate [Bacteroides thetaiotaomicron VPI-5482]
3POH_A	8.94e-68	88	471	67	439	Crystalstructure of an endo-beta-N-acetylglucosaminidase (BT_3987) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.55 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1EDT_A	6.19e-32	186	435	1	247	ChainA, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H, ENDO H [Streptomyces plicatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36911	4.92e-108	188	473	54	339	Endo-beta-N-acetylglucosaminidase F1 OS=Elizabethkingia meningoseptica OX=238 GN=endOF1 PE=1 SV=1
P04067	1.18e-30	190	435	47	289	Endo-beta-N-acetylglucosaminidase H OS=Streptomyces plicatus OX=1922 PE=1 SV=1
P80036	1.09e-20	200	458	61	314	Endo-beta-N-acetylglucosaminidase OS=Flavobacterium sp. (strain SK1022) OX=148444 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000051	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003198_01608.