CAZyme Information: MGYG000003201_00907

Basic Information

• Species: CAG-873 sp900759825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900759825
• CAZyme ID: MGYG000003201_00907
• CAZy Family: GH27
• CAZyme Description: Isomalto-dextranase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487		54897.75	4.9036

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003201	2637500	MAG	United States	North America

• Gene Location: Start: 2340; End: 3803 Strand: -

Full Sequence      

MTRFSTITKFVAAAIFCSAVSLTACGDDNKGGTVPGTPDEPDPTPGLPELPVPGEIHTYK
APLYWTIYEYAREWELAGVPYDQMDLSSDQWDAVIDMMATRFKPYGYDMICTDGFLPQTA
RDGGIYMSHYGSMPLKELVRRARAKGLRVGVYDNPLWIKGNLDSKVPGTDYTLRSLTRNP
QDKVLYPQVTDRPDFTWLVTDHPGAREYIDGWFKHYHDMGVDFVRMDFMCWYEDGDPGRD
YPVTCGYGRERYERGLAYICESAAKYGIFTSIVMPELYNDAELESKYCNMTRIVQDTNIG
GWHHFSSFNRGVIYNRWPYADNQLDGFAHWSHIGGRGKVILDGDFLRLNKCSNDDERRSQ
VSLQLIAGGPVAIADTPESIGNLDSFYTNEELLALNTDGFVGKPLSDAIDSEGSRIWWGT
MTNGDVVIAMFNRDEAGKKMSVNLSDLTLQGEYKVRDLWRHADEGTVTGTFEASVPRHGC
KVVKLTK

Enzyme Prediction     

No EC number prediction in MGYG000003201_00907.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	208	464	2.3e-32	0.9388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17801	Melibiase_C	2.47e-18	413	485	3	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
cd14792	GH27	8.00e-11	93	398	22	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
PLN02808	PLN02808	1.12e-10	322	486	221	384	alpha-galactosidase
PLN02229	PLN02229	5.05e-09	355	486	281	418	alpha-galactosidase
PLN02899	PLN02899	3.49e-07	403	486	539	631	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF13305.1	3.80e-296	50	485	36	471
QNT67171.1	9.46e-176	47	485	34	473
QUT44530.1	1.41e-164	23	487	20	492
QUT79686.1	1.41e-164	23	487	20	492
QUU07210.1	4.01e-164	23	487	20	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AWO_A	2.76e-71	62	486	38	466	Arthrobacterglobiformis T6 isomalto-dextranse [Arthrobacter globiformis],5AWP_A Arthrobacter globiformis T6 isomalto-dextranase complexed with isomaltose [Arthrobacter globiformis],5AWQ_A Arthrobacter globiformis T6 isomalto-dextranse complexed with panose [Arthrobacter globiformis]
4NX0_A	2.35e-12	72	486	30	441	Crystalstructure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_B Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_C Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_D Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_E Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_F Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_G Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_H Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44052	1.00e-71	62	486	64	492	Isomalto-dextranase OS=Arthrobacter globiformis OX=1665 GN=imd PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000020	1.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003201_00907.