CAZyme Information: MGYG000003201_00908

Basic Information

• Species: CAG-873 sp900759825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900759825
• CAZyme ID: MGYG000003201_00908
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746		80757.33	5.1195

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003201	2637500	MAG	United States	North America

• Gene Location: Start: 34; End: 2274 Strand: -

Full Sequence      

MKKIVLGMAFLAGTALAGIAQTPAYLDDTRPIDERVEDALSRMTVADKIGIIHAQSKFSS
AGVQRLGIPGIWCTDGPHGIRPDVLWDEWDQAGATNDSCVAFPALTALAATWDPDMAALY
GKSIGEEARYRNKNVLLGPGVNIYRTPLNGRNFEYMGEDPLLAARMVVPYIKGVQNNGVA
ACVKHYALNNQEQDRDHVDVRVDDRTLHEIYLPAFKAAVKDGQAWAIMPGYNKYDGEHAC
ENAVLLLDILKRDWGFDGVAISDWGAVHNTEKVAPNGLDMEFGSWTNGLNWGASNAYDNY
FLAKPYEKLLAEGKLPMSDLDDKARRVLKLIFRTEMNRNRPYGSLNSDEHYAAARRIGAD
GVVLLKNDGNLLPVADKVRKILVVGENAIKMMTVGGGSSSLKVQRETLPLDGIRAAASER
GIEVAYERGYVGDVTGEYNGVVTGQDLSDSRSAEQLRADAVRAARDADLVIFVGGLNKSD
HQDAEGNDRLAYDLPYGQNELISALAAANPALVVVGVTGNAYAMPWLAEVPALVQGWYLG
SEAGNALADVLFGKVNPSGHLPMTFAAALTDYAPHATDDSTMYPGVDGIVTYKEGLGVGY
RHTDRLKRSRVNFPFGHGLSYTTFKLGKPSLSATELTSDAPVTVTVPVTNTGSREGAEVV
QVYVRDVKSSVDRPLKELKGFAKVTLAPGATADVEIPLDRDAFAYYDPATKLWTVEPGKF
EILVGTSSADITARLPLTAPAMSWKD

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	281	3.1e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.96e-103	1	732	1	758	beta-glucosidase BglX.
COG1472	BglX	3.65e-76	65	423	57	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.28e-56	362	600	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	4.20e-56	25	699	42	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.28e-36	65	330	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74223.1	0.0	2	736	4	737
BBL02169.1	0.0	11	731	16	735
QMI79977.1	0.0	1	736	1	737
QPH58875.1	0.0	1	736	1	737
QUU01284.1	0.0	1	736	1	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	4.01e-150	36	734	5	663	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.13e-133	32	733	1	657	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	4.77e-111	11	731	30	820	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
3AC0_A	1.01e-109	36	731	6	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.59e-106	36	731	6	828	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	4.05e-266	1	731	6	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	2.20e-149	36	734	5	663	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	3.11e-146	36	740	2	811	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
F6C6C1	2.78e-128	32	744	1	684	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	9.04e-126	32	731	1	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000563	0.998612	0.000250	0.000196	0.000189	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003201_00908.