CAZyme Information: MGYG000003201_01774

Basic Information

• Species: CAG-873 sp900759825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900759825
• CAZyme ID: MGYG000003201_01774
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
672	MGYG000003201_363|CGC1	74443.79	6.3647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003201	2637500	MAG	United States	North America

• Gene Location: Start: 6338; End: 8356 Strand: +

Full Sequence      

MYKSAVLLSLLGGALCAAAGQPAQGAPSGYPYTPVPFTSVHVSGPFWGARLEASRNVTIP
LAFAKCEENERYANFVRAAHPSDEYKVEGFSFDDTDVYKTIEGAAYRLSNFPDKRLEAYV
DSVIDIMAAAQEPDGYLYTARTQNPAHPHPWGGASRWVEVENLSHEFYNLGHMIEGAVAY
WQATGKRKFLDIAIRFADCVCRNIGEGEGKLRLVPGHQIAEMALVRLYNATGDRKYLDQA
RYFLDARGTTRRRQEYSQSHVPVLQQTEAVGHAVRATYMYAGMADVAAMTGDTAYIHAID
RIWDNIVGKKLYITGGIGATHRGEAFGANYELPNATAYNETCAAIGNVYTNYRLFLLHGD
AKYYDVLERTLYNGLISGVSIDGGSFFYPNPLASYGDYSRKPWFGCACCPSNISRFIPSL
PGYIYAVRDRDLYVNLFIPNSADLEVGGRKIKLSQTTGYPWTGDVNITVDKGSADMALNI
RIPGWVRNSPVPGDLYAYTDSLVPTYSVKVNGRDYAGELRDGYLVIPGRWKRGDRVDISF
DMPVRTVRAHDNVEADRGRLAVERGPLVYCAEWPDNSFNVHTTLLRRHPEFKLGELTDEL
GGIRKITTEVQSLSYAPDGTLAVTPQTLTLIPYYAWAHRGEGDMAVWLPADISAATATTP
GAVEREDNGFFH

Enzyme Prediction     

No EC number prediction in MGYG000003201_01774.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	40	570	1.8e-204	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	39	570	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.56e-177	34	651	11	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd00249	AGE	0.002	171	304	176	332	AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid. Catalytic mechanism is believed to be via nucleotide elimination and readdition and is ATP modulated. AGE is structurally and mechanistically distinct from the other four types of epimerases. The AGE domain monomer is composed of an alpha(6)/alpha(6)-barrel, the structure of which is also found in glucoamylase and cellulase. The active form is a homodimer. The alignment also contains subtype III mannose 6-phosphate isomerases.
COG1331	YyaL	0.003	173	241	473	561	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04791	LanC_SerThrkinase	0.004	180	302	98	230	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW86046.1	0.0	29	671	24	666
AAO78779.1	0.0	29	671	24	666
QPH58081.1	0.0	18	657	17	664
QBJ17728.1	0.0	18	657	17	664
ALJ44137.1	0.0	29	671	24	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	0.0	29	671	4	646	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.42e-144	38	648	14	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.42e-139	38	648	14	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.22e-117	39	647	2	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.66e-117	39	647	2	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	6.71e-117	39	647	2	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000416	0.998890	0.000175	0.000175	0.000156	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003201_01774.