CAZyme Information: MGYG000003201_01813

Basic Information

• Species: CAG-873 sp900759825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900759825
• CAZyme ID: MGYG000003201_01813
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684		76286.72	6.0207

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003201	2637500	MAG	United States	North America

• Gene Location: Start: 2618; End: 4672 Strand: +

Full Sequence      

MKHIVLAALCSVAAGVTCAQDAWRITAEAPDPHNYYGVTVANGQLGILSSPEPLRTERVV
LGGLYDTYGHSGRTNNFVHAVRMLDLEMRIDGERVSRRNISHYRQELVMDSALMEGSFNV
DSRAAVSYAYCALRQLPFSALMTVSVTAHRDITMQVENVLTADESLVDADEYFTTVRNPP
YTYNIATTVARTPTKKLETASSAVIIPDRAYAAPEIRHWSTRGTGVHTQEFTVNLKAGQT
YTFSVIGTALSEVTHHDVRNDAERLSMFAAVEGPDRLLARHLQEWDKLWQSDIVIEGDAQ
AQQDVHSMIYHMYSFVREGSGLSLSPMGLSGFGYNGHVFWDTETWVYPALLLLQPDMARS
LLEYRYDRLDAARRNAYQHGYRGAMFPWESAASGEEETPSHNMYSNFEVHINADIALAAW
QYYCVTGDREWLRERGWPLISSTADFWVSRVEPRRDGSAGYELVNVIGADEWGVNPGGGK
NVDNNAYTTGSAINNLALARKAARALGITPDPDWERVRAGLRLDRQDDGTIRLHDTWHGE
KTKQIDVGLLAYPLGLITDPDDIRRNLERYIPTVPRKATPAMSKSVYSILYSQLGDSDKA
LEYFRDSYLPNLNPPFRVIAEFDGGTNPYFITGAGGTLQSVMMGFGGLRITDKGITPTGA
RLPAQWKSLTLRGIGPDRETYTLK

Enzyme Prediction     

No EC number prediction in MGYG000003201_01813.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	308	652	3.6e-95	0.989247311827957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	2.68e-95	39	672	31	721	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	1.02e-65	309	652	4	384	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	4.78e-46	228	672	240	710	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	7.57e-04	39	243	18	231	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39214.1	5.67e-288	19	684	23	685
QEC67782.1	1.67e-250	1	684	1	676
AHJ97309.1	1.17e-246	2	683	6	678
QEC65248.1	3.01e-246	3	684	5	677
QEM10436.1	2.80e-245	1	684	7	681

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	2.95e-235	20	683	21	676	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	1.34e-51	228	669	227	714	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	2.09e-36	78	678	82	718	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTP_A	3.95e-36	231	674	225	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	5.28e-36	231	674	225	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	5.33e-66	214	683	192	659	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
F1NZI4	3.62e-57	248	674	212	637	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
Q8BP56	3.85e-56	281	656	230	609	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Mus musculus OX=10090 GN=Pgghg PE=1 SV=1
Q32M88	1.87e-55	277	656	227	610	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Homo sapiens OX=9606 GN=PGGHG PE=1 SV=2
Q8L163	7.50e-55	258	672	277	735	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000436	0.998762	0.000268	0.000182	0.000175	0.000178

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003201_01813.