CAZyme Information: MGYG000003201_01926

Basic Information

• Species: CAG-873 sp900759825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp900759825
• CAZyme ID: MGYG000003201_01926
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	MGYG000003201_389|CGC1	73811.9	5.6389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003201	2637500	MAG	United States	North America

• Gene Location: Start: 11624; End: 13600 Strand: +

Full Sequence      

MRRFLILAIIALSVHAVSARTISGETVTLETLSEDATVNNGGTLVLTGDNPMGNHSVDLA
DHSCSLILSCAKPTQALEWMSSVTIGGKPFDPERDRLSMYGHGSEVIPDGWTAPLTIYSG
ANYTGENMVCDADIYYRCKKVAAGKSYLEQQLLGAMDNNIRSFRLKRGYSACFANNNDGT
GFSRVFVATDRDLEVAEMPEGLEFASFVRVARADRIGKQGICGLDMVALTRSPWYYSWGA
SDDSKDDYEFVPMRHNRYWDGYDKIGSRIQTFNVLGFNEPDHGDQSNISVYEAMGMWPDM
MASGLRAGSPAPDAITKGWLKEFIQYADSLCYRVDFVATHMYWDSQTPEGLTRQINNLCE
QNYGGRPMWITEWNNGANWTGEAWPDREGLRLDADFEPLYEEDGSRISVARPHTQANSKK
MCDWLGPMLQALDDCKWLERHSLYNWVEDARMLVINNKLTPAGKIFADFRSQPGFDHSRE
YIHRWHIAPPYLKVRKYTSYSEIQFYDHNGETGINYIVERRKGKTGKWEVVTTLVNGVDY
KRPGNFNTFRDMTIPEAGHYQYRMRATSYKGELSLYSRIVDIDAPVSGISEAAAEAAPTV
TAQGNTLTITSPRGADYAIYAIDGRMAANVYASPDAPATVELPSGIYFVNHRKIALGR

Enzyme Prediction     

No EC number prediction in MGYG000003201_01926.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	233	464	1.3e-32	0.9419642857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11790	Glyco_hydro_cc	2.04e-20	234	374	20	170	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
pfam01229	Glyco_hydro_39	0.004	232	376	108	274	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUC19783.1	3.46e-120	32	609	372	946
APZ45921.1	3.46e-120	32	609	372	946
AXY72824.1	1.25e-96	44	577	408	904
AEV99551.1	6.70e-93	46	577	432	940
BAV05333.1	9.67e-93	50	650	565	1144

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAQ_A	1.22e-16	234	373	47	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	3.00e-16	234	373	47	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	7.39e-16	234	371	47	192	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]
6UAT_A	7.39e-16	234	373	47	194	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei],6UAU_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E102A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose and laminaribiose [Amycolatopsis mediterranei]
6UAY_A	2.51e-11	198	372	15	207	Crystalstructure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000342	0.998915	0.000171	0.000201	0.000182	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003201_01926.