CAZyme Information: MGYG000003202_01440

Basic Information

• Species: UBA3263 sp900759865
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA3263; UBA3263 sp900759865
• CAZyme ID: MGYG000003202_01440
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
919		102229.16	4.6031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003202	2219551	MAG	United States	North America

• Gene Location: Start: 12016; End: 14775 Strand: -

Full Sequence      

MLKKIALSAALLAGLGLHAADSSGIFPNPQEETVGTTAFATAGVTYRLTGSADADADAVN
ALGRKLNVADAGTVEIVIGEAGDDAVASVSNLIPEYPQGYYLKVEPGKVTIAGRDALGTY
YGVQSYLQLAAKAEVPSVEVKDWPRTEVRGVIEGYYGNPWSHEDCIDMCTFFDHVKMNTF
IYGPKNDAYHHGGKVFDPYPEDQAANLAALVREANSHKVDIVWAMHPGNNNDGANLERAK
SKLEAMYDLGFRRFAVFFDDISANSVQKQYEFMNYLNKNVVKAKGDVKGLIMCPSEYCIS
FAGGQNTKSTYLNELGAGLDPDIDIMWTGWQVVDMELAPSCEWFTNKTGRKPFIWHNSPC
SDYGGRPLLMCPYEPAATDLPSRITGFTANPMEYYEASKVGLYGMGDFAWNPEAYDPWET
WEESLAYMMPDHTDAFRTYCYDNFNYPSKSHGPAIIYQESPAFKELIDSKEFTAENAESY
TAYFNKQLEAALELRALTDNRLVIEIAEWLHAYELQGRRGLMLTELMKNLAERDADKFLE
SYTAYAEYTATAEALRSRDYEGTLRVLTPFSGSQFIEPFIANNVEKFVEEFKALGVPYPP
GLFPARTIESGQYHILYNGKFLTNRSGSSYPTFTADADMVNPNRQIWSISYVPETGRYSL
VSAEDSRYVNELGNFGTNEYSAVWNTYNIVPLGSLWSIQNGGNGGTKFWRASAVRVQPGD
NTDWSTDNFMFQIVPAGSEIPEAPAEPFADGEYVIKDGAGNLLTRSTSNSKVTFTAAGET
VTDFQKWNVTLDATSKRFKIAQGTKYINEKGVIGTNQYYPEWNSYQITGRDGKFSIRNAG
EAGTRFWTVDGDGIGFADYTGSLVDHWVFDFELVSKFNSIREVNAAQTVDDSVYDLQGRK
VAKPRNGIFIQNGQKVLFK

Enzyme Prediction     

No EC number prediction in MGYG000003202_01440.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	149	438	1.2e-86	0.9864406779661017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.41e-112	149	438	1	292	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	1.75e-11	25	142	4	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13183.1	3.87e-168	1	737	1	736
QUB43766.1	2.82e-121	7	669	5	669
QQT77482.1	1.82e-108	7	529	9	539
ASM65960.1	1.82e-108	7	529	9	539
QRP57274.1	1.82e-108	7	529	9	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	3.86e-106	7	542	9	549	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
5MI4_A	8.17e-106	46	542	36	539	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J4G_A	1.18e-105	46	542	24	527	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	1.21e-105	46	542	25	528	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2CHO_A	1.21e-105	46	542	25	528	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	2.11e-105	7	542	9	549	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	3.92e-69	27	496	48	541	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	9.83e-69	27	496	48	541	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	1.30e-38	102	582	136	646	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	7.23e-33	150	403	63	326	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000305	0.998995	0.000194	0.000177	0.000170	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003202_01440.