CAZyme Information: MGYG000003203_01387

Basic Information

• Species: Butyricimonas sp900759925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas sp900759925
• CAZyme ID: MGYG000003203_01387
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000003203_161|CGC1	35358.28	6.3817

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003203	5334161	MAG	United States	North America

• Gene Location: Start: 19; End: 939 Strand: +

Full Sequence      

MNMEEIWALINMAEKKQLHCMMLENCVYDFFELTTLNMAQHDVFGEILHVEGAYIHNLDE
FWAYYWNNWRMDYNRKHRGDIYATHGMGPACQLLDIHRGDKMNYLVSMDTKAVSAPEYIK
NKTGEDVKDFKNGQHTITLIRTENGKTIQMQHNVTSPRPYSRMYQLTGTRGFANKYPVEG
YALQPSQVSSDVMPDHENLNAHGFVPQDVKKALMEKYKHPIQKELEEQAKKVGGHGGMDF
IMDYRLVYCLRNGLPLDMDVYDLAEWCCLGELTGISLENNSAPVAVPDFTRGGWNRIKGY
RHAMVE

Enzyme Prediction     

No EC number prediction in MGYG000003203_01387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	295	5.1e-114	0.7167919799498746

CDD Domains     

MGYG000003203_01387 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS31970.1	5.65e-218	1	306	150	455
QRO51930.1	5.38e-216	1	306	150	455
QCQ53891.1	9.82e-186	1	306	159	464
QCQ44925.1	9.82e-186	1	306	159	464
QCQ36004.1	9.82e-186	1	306	159	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	6.31e-59	2	294	149	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	8.32e-44	3	298	128	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C863	5.61e-186	1	306	159	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	5.61e-186	1	306	159	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
Q7MWF4	1.16e-181	1	306	163	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2
Q89ZX8	1.30e-180	1	306	162	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	2.69e-176	1	306	166	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003203_01387.