CAZyme Information: MGYG000003204_00705

Basic Information

• Species: HGM05232 sp900759955
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; HGM05232; HGM05232 sp900759955
• CAZyme ID: MGYG000003204_00705
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	MGYG000003204_100|CGC1	52505.31	9.0235

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003204	2758848	MAG	United States	North America

• Gene Location: Start: 5388; End: 6779 Strand: +

Full Sequence      

MKQLPGLLVIIIVLAFIASAACKRNTTSTGNSAVSHKLPDTLRVGTLYSPTSYFIYKGEQ
MGYEYELISKFAQEKNISLDVKVARNMNAMLEMLDSGIIDIIAYEIPITAEYKDRVLHCG
VENITRQVLIQPKKQDRKEMITDVTGLIGKDVYVEKGSKYESRLNNLDNELGGGIKIHAV
DQDTLISEDLIEMVSEGKLPLTVVDSDIARLNRTYYDNIDISLDVSFPQRASWAVNKTNK
WLADSINKWSGLSESKDSYKMLLKRYFELSKNTTTPYSFDLKKGRISQYDHLFKKYAKEI
GWDWRLLAAQAYSESHFDTAVVSWAGARGIMQLMPGTARAYGLKPSEVTNPELNIKAAVK
SIKDLEKSLSTKIKDPKERLKFIIAAYNSGIGHVYDAIALAEKYNKNPEVWEGNVKETIL
LKSNPEYFNDEVCRFGYFKGRQTVTYVAKVLDIYQLYRSKIPH

Enzyme Prediction     

No EC number prediction in MGYG000003204_00705.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	300	457	2.6e-26	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10859	PRK10859	1.48e-88	1	455	1	448	membrane-bound lytic murein transglycosylase MltF.
cd13403	MLTF-like	1.20e-78	293	458	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	2.21e-69	42	450	25	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd01009	PBP2_YfhD_N	1.23e-64	41	268	2	223	The solute binding domain of YfhD proteins, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes the solute binding domain YfhD_N. These domains are found in the YfhD proteins that are predicted to function as lytic transglycosylases that cleave the glycosidic bond between N-acetylmuramic acid and N-acetylglucosamin in peptidoglycan, while the YfhD_N domain might act as an auxiliary or regulatory subunit. In addition to periplasmic solute binding domain, they have an SLT domain, typically found in soluble lytic transglycosylases, and a C-terminal low complexity domain. The YfhD proteins might have been recruited to create localized cell wall openings required for transport of large substrates such as DNA. They belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.
pfam01464	SLT	1.03e-22	293	407	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB37997.1	6.47e-194	11	455	12	454
QQR08735.1	6.47e-194	11	455	12	454
ANU63911.1	6.47e-194	11	455	12	454
AHF13148.1	4.60e-192	42	462	45	463
QCD43102.1	1.92e-183	21	460	20	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OYV_A	5.49e-40	42	456	20	427	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OZ9_A	3.39e-39	42	456	13	420	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	3.84e-39	42	456	20	427	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA2_A	5.57e-39	16	456	30	461	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA1_A	5.57e-39	16	456	30	461	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_B Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	2.18e-53	52	460	53	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q3KHL5	6.26e-50	42	456	43	450	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mltF PE=3 SV=1
B1JDH3	1.65e-49	42	456	43	450	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain W619) OX=390235 GN=mltF PE=3 SV=1
Q4KHS7	4.53e-49	42	456	43	450	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2
B0KRE9	2.31e-47	42	456	43	450	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000119	0.048736	0.951097	0.000027	0.000034	0.000027

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003204_00705.