CAZyme Information: MGYG000003204_02050

Basic Information

• Species: HGM05232 sp900759955
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; HGM05232; HGM05232 sp900759955
• CAZyme ID: MGYG000003204_02050
• CAZy Family: GH20
• CAZyme Description: N,N'-diacetylchitobiase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839		95642.1	7.6729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003204	2758848	MAG	United States	North America

• Gene Location: Start: 21934; End: 24453 Strand: +

Full Sequence      

MNPLPSVKYHLKKTWLIILFVMTSTSFIKASNPPLTVSWEVIENGVKPNFYSNRFVITNS
GDKTLGNNWEFYYNHFSRKIELPAGSPVVIDEIRPSYYRMRPSDKFQPLAPGESVNIDMN
TRGIFINYCYGPDGGYFIDKKYPDKPVAIKIIRPVMNDPKQWTVPGRKSKPYPDGNYIYN
LNKKVNPENAKYEGGMYDIFPTPKSTESIGGNTIINKEVRITSQTGLQSTEKYLTDKLKS
IGIEQTRTGNATEINLKLLPDKSANKEYYELRVENNAITIEGTSAAGVLNGIKTLIAVLE
KNELPVSLPNVLIKDYPDLEYRGMMLDIARNFTTFDNIKTLIDRLASYKINKFHFHFSDD
EGWRLEIPGLPELTQVGSRRGHTLDENEFLFQTFTGTGNPDDNSTGNGYYTRKQFIELLK
YASQRGIDIIPEIESPGHARAAIYSMKARYNKYRNTDRKEAAKYIIWDDKDTSVYTSAQN
FHDNVLDISSEGTYNFMEKVIDELISMYKDAGVELAAIHIGGDEVPHGSWEGSPNVADFM
KKRNMKNVHEAGEYFLTRVTKILDSKGVKANGWQEVAMHHPKNMDKEIAPRFAGVNVWST
VGKNDTVAYSIANAGYDVILSNVNNLYLDMSYTPHQYEPGLNWGGYVDEFASWNTQPFNN
YRSERYTNTGEPANLNTAADGKPQLTESSKKHIKGLEAHIFSEAIRNYDMVEYYTFPKIL
GMVERSWNAEPSWGKEYSDMTKYDNERIQYNLKIGTMELPRLHRKKSNFRVWQPGITIID
GLLHANAIYPGVEIRYTTDGSEPTINSTRWTEPVPCNAKLIKAKSFYLGKQSLTTYLFQ

Enzyme Prediction     

No EC number prediction in MGYG000003204_02050.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	320	729	5.9e-96	0.9554896142433235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06569	GH20_Sm-chitobiase-like	0.0	315	749	1	436	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06563	GH20_chitobiase-like	3.74e-105	320	742	2	355	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	5.30e-103	320	729	2	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	5.12e-86	214	815	136	690	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	5.13e-66	320	734	2	323	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12728.1	3.59e-277	30	835	24	829
QUR45222.1	2.17e-238	7	839	4	835
QUT26545.1	4.34e-238	7	839	4	835
SCV07433.1	8.69e-238	15	839	13	835
QDH53746.1	8.69e-238	15	839	13	835

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QBA_A	1.46e-86	55	802	44	823	BACTERIALCHITOBIASE, GLYCOSYL HYDROLASE FAMILY 20 [Serratia marcescens],1QBB_A BACTERIAL CHITOBIASE COMPLEXED WITH CHITOBIOSE (DINAG) [Serratia marcescens]
1C7T_A	3.86e-86	55	802	44	823	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
1C7S_A	1.96e-85	55	802	44	823	ChainA, BETA-N-ACETYLHEXOSAMINIDASE [Serratia marcescens]
6EZR_A	4.50e-67	199	743	142	619	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZR_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi [Vibrio harveyi],6EZS_A Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6EZS_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase from Vibrio harveyi in complex with N-acetylglucosamine [Vibrio harveyi],6K35_A Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi],6K35_B Crystal structure of GH20 exo beta-N-acetylglucosaminidase from Vibrio harveyi in complex with NAG-thiazoline [Vibrio harveyi]
6EZT_A	5.47e-66	199	743	139	616	Crystalstructure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi],6EZT_B Crystal structure of GH20 Exo beta-N-Acetylglucosaminidase D437A inactive mutant from Vibrio harveyi [Vibrio harveyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04786	1.96e-95	57	800	47	809	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1
P13670	2.60e-88	57	800	71	846	N,N'-diacetylchitobiase OS=Vibrio harveyi OX=669 GN=chb PE=1 SV=1
Q54468	2.46e-85	55	802	71	850	Chitobiase OS=Serratia marcescens OX=615 GN=chb PE=1 SV=1
P49007	3.40e-78	237	749	250	753	Beta-hexosaminidase B OS=Pseudoalteromonas piscicida OX=43662 GN=nag096 PE=3 SV=1
P96155	1.16e-62	199	722	141	600	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000266	0.999138	0.000171	0.000145	0.000133	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003204_02050.