CAZyme Information: MGYG000003205_00287

Basic Information

• Species: CAG-312 sp900760055
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760055
• CAZyme ID: MGYG000003205_00287
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		90609.25	8.6899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003205	2897966	MAG	United States	North America

• Gene Location: Start: 149; End: 2560 Strand: -

Full Sequence      

MCKKIVLIFSFLFLAFAVLRGGNIASRNSASEWAHIPDSFKSAKWVAPAPYGFVYEIVNS
YNLYRKKFDLKTVPAKAPLYITADQSYRLYINGKFVCSGPARGFQHSWPFDEIDAAKYLK
SGKNVLAIRQYNAGRGTFGYISKGHSGAIFALELGGGKTVLSDHTTKGRRQEGCDRNTAQ
FSVPMNNQEHIDLRMEDPRWKDVDFDDSKWEKCQSSRAFNSMPYYNFESRMIPMLEEYEI
YPKKIVSQGVGKASSLAEKVFDSSKLADAEKLEFSAFGGGGLVAEFPPSKDGVRAFVFDF
GVMSVGMPILKIEGAKGGEIIDIRTTELIENNADIVRCGSNLAPANRLVCREGTQIHDFY
HVLGFRYLAVRVRNNPDSTLKIAASMRWSAYPLGDRGKFKTSNVLVNKIWSASRQTQRLC
SLDSYVDTPYREQAQWWGDARVQAWNTFFISGDTRLLRRGIRSISMQKTPNGLTHGYAPD
GMNSCVLPDYSLIWILSVWDYYWQTGDIEPFLTHKDTVDSVFAYFDSVTDSQTGLAKYDP
RYWLFLDWCRIQKKGQPAVLNLWYLHSLDKMAQLCRENGLSADAEKYAARAAKLRGAIKR
NLLLPNGLVSDGILEDGSVNPVTAIHAQTLAKICEIEGFDFQKALDEIILPYVRNEGKEK
APDDFNERMKKVAKPTSYWAVYILKVLCDAGYERDAYDYISRMWAEFADYGSVGEMFNVP
LTSTHSHAWSAHPSFLLPMILGGVKQEAAGWTKISYKPNFFEKSADITYPTPMGDVKVSW
RQNPDGTYTDNISAPKNMTVLKK

Enzyme Prediction     

No EC number prediction in MGYG000003205_00287.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	295	800	3e-86	0.9761904761904762
CBM67	59	222	6e-33	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.05e-25	397	631	4	232	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.93e-09	74	210	3	147	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	7.87e-05	290	377	4	89	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.46e-04	743	799	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDU02729.1	1.72e-209	40	780	13	749
QYY35421.1	1.26e-205	37	798	11	761
SDT92885.1	4.33e-197	40	782	7	741
AHF89243.1	5.04e-197	40	786	16	775
QYM78626.1	7.01e-179	40	800	15	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.34e-43	59	800	21	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	4.19e-21	297	778	195	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6I60_A	3.69e-20	49	797	165	891	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	2.82e-12	28	800	128	874	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	9.14e-08	65	800	174	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KM26	9.82e-08	359	800	694	1132	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000404	0.998962	0.000174	0.000153	0.000134	0.000132

TMHMM  Annotations     

start	end
5	24