CAZyme Information: MGYG000003205_01298

Basic Information

• Species: CAG-312 sp900760055
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760055
• CAZyme ID: MGYG000003205_01298
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		60281.04	9.0413

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003205	2897966	MAG	United States	North America

• Gene Location: Start: 92598; End: 94181 Strand: -

Full Sequence      

MLKKITTIVTALAAIFSAADAKTYKIDISPEAFKTFSASKYASAEKHDGVDAIKFKADDF
LKGGKYEVVKIPVDLSAGKGKNMTITMDVVSDEGLLRTPNEGMFNGGTKIFFTYVKDAQP
VHFSTRPEVGKLKNKFGIMLDIIPEDVLKGELTIGFFNVKGTVYFKNIELEVGKSATYWK
PNLDFDFKCEYSDRLKNCPLMRGAMFSTTYNEKNLEDFRKWNGNLIRVSIGGSPGDNRFT
FGEKEENIINAPDYLQSYYEWLDKSIQTWKQYLDKCQKLGIKVVVGLHSTPGFRYQNKDM
RMFFEDKYADAFIKSWKKIARALNGHPAIWCYDLCNEPIQSRPSKRDYLRLQYQAARAVR
AIDADTPISVEAVNWDNPGAFVFLSPLPLKDIIYQVHMYHPGHLTHQGVFGGMPKKLVAY
PNPASSTLNKKSLVDCLQPVRDFQLKWGARIYVGEFSCVRWSPGNDRYFKDCIDIFEEYG
WDWTYHAFREWNGWSVEHGPDRNDNKPTAEPTPAKKVILEAFKKNKF

Enzyme Prediction     

No EC number prediction in MGYG000003205_01298.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	207	493	8.4e-38	0.7490909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.49e-16	201	486	10	271	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNN21528.1	2.61e-102	55	525	63	517
AVM43397.1	6.44e-101	19	526	17	508
AVM45838.1	1.47e-100	146	525	160	529
AVM45719.1	7.22e-100	36	524	74	549
AVM45720.1	7.43e-99	150	526	200	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.75e-17	206	485	25	315	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	4.24e-17	206	485	25	315	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
4EE9_A	6.05e-07	273	474	75	260	Crystalstructure of the RBcel1 endo-1,4-glucanase [uncultured bacterium],4M24_A Crystal structure of the endo-1,4-glucanase, RBcel1, in complex with cellobiose [uncultured bacterium]
7P6G_A	1.43e-06	273	474	75	260	ChainA, Endoglucanase [uncultured bacterium],7P6G_B Chain B, Endoglucanase [uncultured bacterium],7P6H_A Chain A, Endoglucanase [uncultured bacterium],7P6H_B Chain B, Endoglucanase [uncultured bacterium]
6ZZ3_A	1.89e-06	273	474	75	260	ChainA, Endoglucanase [uncultured bacterium],6ZZ3_B Chain B, Endoglucanase [uncultured bacterium],6ZZ3_C Chain C, Endoglucanase [uncultured bacterium],6ZZ3_D Chain D, Endoglucanase [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	7.12e-17	206	485	25	315	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	7.12e-17	206	485	25	315	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P23340	7.12e-17	206	485	25	315	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P16169	6.51e-09	203	480	15	285	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000376	0.998808	0.000229	0.000191	0.000191	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003205_01298.