CAZyme Information: MGYG000003205_01974

Basic Information

• Species: CAG-312 sp900760055
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760055
• CAZyme ID: MGYG000003205_01974
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000003205_62|CGC1	52116.41	8.2223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003205	2897966	MAG	United States	North America

• Gene Location: Start: 54349; End: 55752 Strand: +

Full Sequence      

MKNKISILSAAAILFAANLSDAQEKTINVDVDVSKSAGIIKPLNGGNLAEKISSTAAGNP
VTEYIAELNMPLIRLHDVPLQNAGLRIVDTDLIFPNMHADENDPRNYCFAPTDDYIAECQ
KTGANVVYRLGVSIDHSVRKYRTAPPDPEKWAKVCIKIIEHLNEGWAEGHNFGIKYFEIW
NEPDGKSRSGKNFQWGGSLEHFADFYAKTAKIIKARFPHIKIGGPAFCYFNKNTFGMFLD
KVKAENAPLDFFSWHKYSDSVEKYIAEPAAVRKFFDERGFKNTELHLNEWHPMYVPWSGL
RRFRDNPDFEKNVSNMTSHEIGVAACSILIGWQDTPLDHAMFYSTGTFGRNWTMFTENGL
PVKLYYPFKAFGQMNKFPRRLAAKSDNKNAYALAGKDGNGRRAVLVSLYKTGKNTLAINI
PGADLSKAEILVCDGVKNLEPAGNAKISDGKIEIPVDADSAAVLVKF

Enzyme Prediction     

No EC number prediction in MGYG000003205_01974.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	67	425	4.3e-36	0.8422273781902552

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.37e-14	143	375	119	351	Glycosyl hydrolases family 39.
cd21510	agarase_cat	3.56e-11	162	257	87	187	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46100.1	6.86e-112	27	460	2	427
QGA22857.1	9.04e-103	9	466	96	548
AVM46102.1	2.97e-84	24	451	2	423
QJD85864.1	1.47e-73	61	464	34	445
QJD82796.1	6.38e-70	27	454	1	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UQJ_A	8.29e-14	140	397	127	369	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
1W91_A	4.50e-13	143	296	122	285	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	4.50e-13	143	296	122	285	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2BFG_A	2.47e-12	143	296	122	285	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
4EKJ_A	1.09e-07	140	296	122	287	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	4.36e-12	143	296	122	287	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000284	0.998963	0.000220	0.000177	0.000176	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003205_01974.