CAZyme Information: MGYG000003205_02329

Basic Information

• Species: CAG-312 sp900760055
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; CAG-312; CAG-312 sp900760055
• CAZyme ID: MGYG000003205_02329
• CAZy Family: GH109
• CAZyme Description: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		49006.2	8.9994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003205	2897966	MAG	United States	North America

• Gene Location: Start: 31706; End: 33007 Strand: -

Full Sequence      

MDRRDAIKTVSVAGMAAALPRFSWAEGNKAKLKVGLIGCSGRGMGAVKNMMDAANGSVEL
VAIADLFPDRLELAMKRFGDYQKKFDSCKGNFDIPASRQYSGWDAYKQLLEQGGVDVVIH
ATPPVFRPLHLRAIVEAGKHLFVEKPACVDPTQARELYEIADLADKKGLTIIPGVQRRFH
PGYVEAIKRIQDGQIGDIIAVQAYWLNSRFWIQDGSKLRLQNPDPMQMEYQIRNWFIFRW
TSGDCYVEQHVHNLDVVRWALGKDPLEVNGVGGRRWDIPYPMLGDRYSHFAVDFDFGNGL
HCASYSRRENKSKDYVLERFVGTKGILETNENRMQRITGSKPWEAPKDQPQALVEEHRVL
IDSVLNNKKINMLRDMVGSTLMAIAGRESCYSGTNFKFGWIAQKSKQNLAPKEWKFGVHD
IDPIPLPGEYKLS

Enzyme Prediction     

No EC number prediction in MGYG000003205_02329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	30	208	1.3e-16	0.40852130325814534

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	6.38e-43	31	394	3	336	Predicted dehydrogenase [General function prediction only].
TIGR04380	myo_inos_iolG	3.18e-25	31	394	1	327	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
pfam01408	GFO_IDH_MocA	7.12e-14	32	174	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK10206	PRK10206	8.00e-11	108	209	58	156	putative oxidoreductase; Provisional
PRK11579	PRK11579	1.59e-05	107	198	57	145	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWI08226.1	4.44e-104	10	428	16	425
AOS46431.1	3.01e-102	2	432	10	431
ARU41414.1	2.12e-96	1	433	6	417
AQT66975.1	6.95e-96	2	432	12	424
QXD26316.1	9.06e-95	3	432	10	429

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4N54_A	7.08e-17	32	389	15	341	ChainA, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_B Chain B, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_C Chain C, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_D Chain D, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
4MKX_A	7.27e-17	32	389	18	344	ChainA, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4MKZ_A Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
4HKT_A	5.38e-14	32	333	4	255	Crystalstructure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_B Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_C Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_D Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021]
3CEA_A	1.13e-12	32	350	9	269	ChainA, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_B Chain B, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_C Chain C, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_D Chain D, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1]
5A02_A	6.37e-11	92	328	52	260	Crystalstructure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A03_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A04_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A05_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A06_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O68965	3.68e-14	32	333	3	254	Inositol 2-dehydrogenase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=idhA PE=1 SV=2
P40332	1.94e-11	108	338	61	264	scyllo-inositol 2-dehydrogenase (NAD(+)) OS=Bacillus subtilis (strain 168) OX=224308 GN=iolX PE=1 SV=2
P09400	2.75e-10	116	327	67	244	Streptomycin biosynthesis protein StrI OS=Streptomyces griseus OX=1911 GN=strI PE=3 SV=1
A8H2K3	1.63e-08	32	211	53	217	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1
A6KX96	1.68e-08	32	341	61	335	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000007	0.000014	0.000000	0.999969	0.000003	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003205_02329.