CAZyme Information: MGYG000003208_01597

Basic Information

• Species: Pseudomonas_E extremaustralis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E extremaustralis
• CAZyme ID: MGYG000003208_01597
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745	MGYG000003208_23|CGC1	84230.95	5.6878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003208	6254364	MAG	United States	North America

• Gene Location: Start: 18912; End: 21149 Strand: -

Full Sequence      

MSFTNNEPLHVKLTAMPASKDVEALVRAEHHDPFSILGPHDDEQGGQFIRAFLPEALSVQ
VLNRDGDETIGSLDATGVPGLFVGHFSTRQAYLLKIQWAGGEQITEDPYSFSQLLLGEMD
LYLFAEGNHRDLGNCLGAQVTSVDGVQGVRFSVWAPNARRVSVVGDFNAWDGRRHPMRLR
HPSGVWEIFIPRLQPGAAYKYEILGAHGILPLKADPMALATQLPPDTASKVAAPLQMDWQ
DQAWMQSRVERHKHTAPLSIYELHVGSWQCELDEAGEVARQYNWRELAERLVPYVLELGF
THVELMPIMEHPFGGSWGYQALSQFAPTARFGSPQDFAYFVNALHQADIGVILDWVPAHF
PTDAHGLVQFDGTALYEYANPLEGFHQDWDTLIYNLGRTEVHGFMLASALYWLKHFHVDG
LRVDAVASMLYRDYSRKAGEWVPNRHGGRENLEAIDFLRHLNDVVALEAPGALVIAEEST
AWPGVSQPTQQGGLGFNYKWNMGWMHDSLHYIQQDPVYRAHHHNELSFGLVYAWSERFIL
PISHDEVVYGKHSLIDKMPGDRWQKFANLRAYLTFMWTHPGKKLLFMGCEFGQWREWNHD
QQLDWYLLQYPEHRGVQKLVGDLNRLYREEPALHEQDDVPQGFQWLIGDDAINSVYAWLR
WSKDGTPVLVVANFTPVPRAAYSVGVPFAGRWNEVLNSDADTYAGSNYGNGGGVFTRDEP
HHGQAVSLSLNLPPLGVLILRPEPL

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	293	593	1.2e-162	0.9966777408637874
CBM48	136	221	1.8e-21	0.8947368421052632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	115	745	6	630	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	136	742	27	621	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	8	742	500	1222	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	115	742	5	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	17	744	1	725	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDF04985.1	0.0	1	745	1	745
QDG60355.1	0.0	1	743	1	743
QDH65120.1	0.0	1	743	1	743
AUG07481.1	0.0	1	743	1	743
QTV17350.1	0.0	1	745	1	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	5.90e-263	123	743	1	615	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	2.29e-261	136	743	9	610	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	1.91e-255	13	744	21	775	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	5.41e-255	13	744	21	775	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	1.09e-254	13	744	21	775	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4KCQ3	0.0	1	743	1	742	1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=glgB PE=3 SV=1
Q5H6H2	0.0	22	742	18	730	1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) OX=291331 GN=glgB1 PE=3 SV=1
Q4ZTJ2	0.0	15	743	13	739	1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=glgB PE=3 SV=1
Q4V0E2	0.0	24	743	12	723	1,4-alpha-glucan branching enzyme GlgB 1 OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=glgB1 PE=3 SV=1
Q881X0	0.0	15	743	13	739	1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003208_01597.