CAZyme Information: MGYG000003208_03302

Basic Information

• Species: Pseudomonas_E extremaustralis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E extremaustralis
• CAZyme ID: MGYG000003208_03302
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
153	MGYG000003208_55|CGC1	17381.87	7.772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003208	6254364	MAG	United States	North America

• Gene Location: Start: 57297; End: 57758 Strand: -

Full Sequence      

MGKCWRMGWLLSILLGGNQALAYCWEETARRYDIEPELLQAIADVESGFRADAINHGNRN
GTRDIGLMQINSIHLPRLLKQGITEERLLSEPCLSVEVGASILAEFIQRFGYNWTAVGSY
NVGAGSGPQREALRRRYAEKIWTRYEALVMQRH

Enzyme Prediction     

No EC number prediction in MGYG000003208_03302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	23	150	5.8e-22	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	1.34e-58	6	150	3	144	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	3.94e-52	32	146	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.47e-26	25	142	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	1.42e-20	9	148	4	145	lytic transglycosylase; Provisional
cd00254	LT-like	1.39e-14	36	146	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDE53842.1	3.43e-110	1	153	11	163
AZE74372.1	8.97e-88	1	152	1	152
AZE79976.1	8.97e-88	1	152	1	152
SDL52994.1	1.81e-87	1	152	1	152
QTV15635.1	7.36e-87	8	153	8	153

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.22e-14	24	108	3	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	4.20e-44	9	148	10	142	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	4.20e-44	9	148	10	142	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	1.70e-43	9	148	10	142	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q07568	1.15e-34	22	145	18	138	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	3.26e-34	22	145	18	138	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000367	0.998977	0.000169	0.000164	0.000156	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003208_03302.