CAZyme Information: MGYG000003208_03463

Basic Information

• Species: Pseudomonas_E extremaustralis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E extremaustralis
• CAZyme ID: MGYG000003208_03463
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
936	MGYG000003208_62|CGC2	104300.24	6.7957

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003208	6254364	MAG	United States	North America

• Gene Location: Start: 20672; End: 23482 Strand: -

Full Sequence      

MEIVFRRTRLRAIAERLLAALALFVGVPAVQAAALPQPASVAFWYADQPPLPELSQFDWA
VVEPGHMTQADVKTLRALGSQPFAYVSVGEFDGNKADIAKAGLTKAVTPIRNDSWNSQVM
DLTSPAWREHLLGRAKALEAQGYAGLFLDTLDSFQLLPEGSREAQRAGLASLLREMHKRQ
PTFKLFFNRGFEVLPELDGVPAAVAFESLYAGWDAAAKRYRPVPESDRKWLLSELEPLRA
KGIPLVAIDYLPPERIEEARKLAKRLRDEGYVPFISTPELDSMGISNVEVQPRRIALVYD
PREGDLTENAGHTLLGGLIEYLGYRIDYLSADALPEHRFSGLYAGIITWMGSGPPEDSSV
FDRWLTKRLDENVPVAFFASLPTENRVLLKRLGLTLAPPPGLQTLTIATQDKTLIGAFEA
PVQPRSRELSAVSVLPQGPKPALSLTGKNGQTFVPVAVGKWGGMALAPYLLESNNERSRW
ILDPFAFLQASLRLPEQPRPDTTTENGRRIATVHIDGDGFPSRAEVRGSPYAGKQVLDEF
IRPNPFLTSVSIIEGEISPHGMSPFLAKELEPLARALFADPKVEVATHTFSHPFFMQPEK
AKDDEDFHPEYGLKMAIPGYDKIDFRREIIGSRDYINQKLTTPEKPVKMVFWPGDALPSA
ETIKLAYDAGLKNVNGASTMLTKAKPSLTGLNPLLRPTEGGLQYYAPIINENVYTNLWKG
PYYGFRDLIETFELTDSPRRLRGLHLYYHFYSSTKQASIKAMEDIYAYMRGQHPISLWMS
DYLDRLHGLYQSSLARTADGGWQIRGMDGLRTVRLDPQMGWPDLMRSQGVAGVRDLPQGR
YVALSSDRALLFLRPDRDSHPALEEANLPLVDWRYLDDKRVSFSFAGQIDLTFSVRSASA
CQVEVDGKRFAGKASAGLWTFQLPMKQVSNGQLVCQ

Enzyme Prediction     

No EC number prediction in MGYG000003208_03463.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	58	280	1.3e-71	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10922	CE4_PelA_like_C	5.58e-126	506	772	1	266	C-terminal Putative NodB-like catalytic domain of PelA-like uncharacterized hypothetical proteins found in bacteria. This family is represented by a protein PelA of unknown function that is encoded by a gene in the pelA-G gene cluster for pellicle production and biofilm formation in Pseudomonas aeruginosa. PelA and most of the family members contain a domain of unknown function, DUF297, in the N-terminus and a C-terminal domain that shows high sequence similarity to the catalytic domain of the six-stranded barrel rhizobial NodB-like proteins, which remove N-linked or O-linked acetyl groups from cell wall polysaccharides and belong to the larger carbohydrate esterase 4 (CE4) superfamily.
COG3868	COG3868	2.06e-70	27	347	6	306	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
COG2342	COG2342	2.22e-12	55	299	42	299	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
pfam03537	Glyco_hydro_114	1.49e-11	49	282	12	221	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDF91579.1	0.0	1	936	1	936
AKV06550.1	0.0	1	935	1	935
QVW24048.1	0.0	1	935	1	936
SDO79326.1	0.0	1	935	1	936
AWY42675.1	0.0	1	935	1	936

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TCB_A	2.99e-112	38	292	24	278	Structureof the glycoside hydrolase domain of PelA from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5TSY_A	2.28e-111	38	292	24	278	Structureof the glycoside hydrolase domain of PelA variant E218A from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
2AAM_A	2.16e-06	63	302	53	306	Crystalstructure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_B Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_C Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_D Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_E Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima],2AAM_F Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9X1D0	2.31e-06	63	302	67	320	Uncharacterized protein TM_1410 OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=TM_1410 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000720	0.998367	0.000227	0.000288	0.000203	0.000174

TMHMM  Annotations     

start	end
13	35