CAZyme Information: MGYG000003209_01381

Basic Information

• Species: Collinsella sp900760215
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900760215
• CAZyme ID: MGYG000003209_01381
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443		48641.96	4.2699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003209	2053088	MAG	United States	North America

• Gene Location: Start: 1185; End: 2516 Strand: -

Full Sequence      

MWGHATSRDLMNWEYVGAPLLPDEPFDCHGVYSGSALAEDGRIRVLYTGNVKLSDADGTY
DYVNTGRRADTVYVESVDGLAGREFSQKRVVLASEDYPDDLTCHVRDPKVWRDDDGRYHM
VLGARRRVDGPHVESRFCAMHGEGAGRDVGEILVYGSADMLSWELESRVSTPERFGFMWE
CPGYLELESDGGVPAKWLSFSPQGLEGGRWDRGNVYAAGYMPVTGDITDGDGEYELGEFR
LWDAGFDFYAPQEFTAEDGRHILIGWMGMPDEPTYGNAPTVACGWQHCMTVPRELTAGAG
GVVLQQPAREIERHYASVRVGESSLEVAGDTCFDVVVDGVDGAFTATVDGELKLAFVLAE
GELPSRFEMRFTDEGRASAGCGRTVRWEPVDEVRNVRIVGDASSVEVFVNDGALVLSTRI
YPEAYGVTADAPGASVTYHTLNI

Enzyme Prediction     

No EC number prediction in MGYG000003209_01381.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	2	307	4.6e-62	0.863481228668942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	4.47e-112	2	296	34	286	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.72e-90	2	422	57	444	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	3.53e-83	2	438	72	477	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	9.39e-78	2	307	40	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	8.95e-70	2	412	40	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA33159.1	0.0	2	443	72	513
SDR64968.1	1.38e-163	1	443	68	483
ADK67558.1	3.26e-154	1	437	68	476
AEB06470.1	3.42e-152	2	441	72	527
AKT49546.1	3.36e-139	1	443	68	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	4.85e-40	2	422	69	459	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
6NUM_A	3.60e-39	2	431	83	499	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]
3PIG_A	4.74e-37	2	436	83	504	beta-fructofuranosidasefrom Bifidobacterium longum [Bifidobacterium longum],3PIG_B beta-fructofuranosidase from Bifidobacterium longum [Bifidobacterium longum],3PIJ_A beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum],3PIJ_B beta-fructofuranosidase from Bifidobacterium longum - complex with fructose [Bifidobacterium longum]
7BWC_A	4.87e-32	2	423	92	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
7BWB_A	4.87e-32	2	423	92	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	3.18e-61	2	435	72	469	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P27217	1.11e-56	2	422	70	439	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P16553	8.16e-53	2	424	67	451	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P40714	1.26e-48	2	423	68	451	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P37075	3.81e-48	2	426	70	443	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003209_01381.