CAZyme Information: MGYG000003211_01163

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591
• CAZyme ID: MGYG000003211_01163
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
564		62751.97	5.2142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003211	2128419	MAG	United States	North America

• Gene Location: Start: 6987; End: 8681 Strand: -

Full Sequence      

MSLIDTLPFAGRDERVRRYLFPRRILKTFGQVTEAEALLREKPLQIGLNESDLTRLSNGP
EGTEKAGILLDFGCELHGGLRLLNAMTDGGPARVRLRFGESVCEAMSEIGEKNATNDHAV
RDMEVLVPALSDQEWGQTGFRFVFIQLLTPRAILSLKAAPAVFIYRELPYKGSFACSDPL
LNRIYDTAAYTCHLNMQGMLWDGIKRDRLVWIGDMHPETLTIRTVFGALPLVEESLEFVR
DQTPLPGWMNGLPAYSMWWLIILWDWYFYTGDGAFLARQRTYALALIRQLAGLVEEDGRD
RVPVYFFDWPTDGTPAAEAGVRALLAIALDKGARLATFYGDGETRLLCEEKRRAIALRQP
ALTPSKSAAAFQALAGLRDASEAAGRIVDGGADGMCTFLSYYILKAAAQGGRMERTLDML
RAYYGAMLEKGATTFWEDLDMSWLEKTAAIDRLPEEGLRDLHGDSGIACYTGYRHSLCHG
WASGPVPFLAEEVLGIRILEPGCRRIALCPRLGSLEWAEGSYPTPLGLLTVNHRRLEDGS
TQTRFEAPQGMEILLPPDQSTAVR

Enzyme Prediction     

No EC number prediction in MGYG000003211_01163.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	64	552	6.2e-91	0.9801587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.51e-15	172	441	4	314	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.27e-04	495	558	1	66	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH21551.1	4.44e-179	12	554	9	556
QBM20341.1	1.13e-178	10	554	19	565
BBE16159.1	7.71e-177	5	555	28	584
AYL96581.1	1.82e-175	10	555	34	586
QEM11316.1	1.42e-174	10	554	34	585

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	4.64e-39	60	531	190	674	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.84e-28	139	553	504	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.30e-12	68	491	95	540	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003211_01163.