CAZyme Information: MGYG000003214_02583

Basic Information

• Species: NSJ-32 sp014384895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32; NSJ-32 sp014384895
• CAZyme ID: MGYG000003214_02583
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453	MGYG000003214_250|CGC1	51757.47	5.4273

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003214	5745180	MAG	United States	North America

• Gene Location: Start: 5473; End: 6834 Strand: -

Full Sequence      

MNHVIHIKFQEVIGQIKPVHGVNNGPLSGSETKDLSRYFRLGGIPLIRFHDTDYPNPRQV
DIPKIFPDFSKDPADAGSYDFRHTDVHMAAAYETGAKVLYRLGTSIEHMKHKVDIYPPKD
YGKWAQICIGIIRHYTQGWADGFTFDVPYWEIWNEPDNNLTKPDMWIGEPDTYYRLYETA
AKVIKAAFPSIKVGGYAGCTIHNEAFREGFLRHVRNTGAPLDFFSWHGYSSTVDQIARDA
VTARERLRAYGLEAAEILCDEWNYIEPVPEFWTKYRQEGSEYLQQELFEKQKSRFGASFL
ASCFVEMQNSPLAACNYYDAQPSSSWCGMFNLYGVPQPAFYSFVAFNALYRLGRQVAVQP
EAQTPQCLAARDEKNMAILLSHHGEGEIEGCLDLELDAGFPMAAEFYLLQDLGGLQQIKT
EVYCTDQIQQYYTMDSNSVLLIKLHPMKEREVS

Enzyme Prediction     

No EC number prediction in MGYG000003214_02583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	72	385	6.6e-44	0.740139211136891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	9.65e-20	71	349	66	350	Glycosyl hydrolases family 39.
cd21510	agarase_cat	5.36e-05	141	229	92	187	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.
COG3664	XynB	6.12e-05	115	357	77	299	Beta-xylosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD85864.1	3.52e-110	16	443	15	446
QJD82796.1	7.39e-102	5	384	3	380
QTH43246.1	5.70e-101	5	384	3	380
QEL16017.1	8.78e-86	16	383	38	407
VTS01610.1	3.71e-84	16	354	39	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z3K_A	1.11e-35	11	263	15	266	Crystalstructure of glucosidase from Croceicoccus marinus at 1.8 Angstrom resolution [Croceicoccus marinus],5Z3K_B Crystal structure of glucosidase from Croceicoccus marinus at 1.8 Angstrom resolution [Croceicoccus marinus]
4M29_A	1.29e-12	79	379	81	384	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	2.28e-12	79	379	81	384	ChainA, Beta-xylosidase [Caulobacter vibrioides]
6UQJ_A	1.46e-08	120	380	134	390	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30360	2.27e-12	79	379	77	381	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003214_02583.