CAZyme Information: MGYG000003214_02778

Basic Information

• Species: NSJ-32 sp014384895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32; NSJ-32 sp014384895
• CAZyme ID: MGYG000003214_02778
• CAZy Family: GT2
• CAZyme Description: Surfactin synthase subunit 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2073		232860.05	4.9374

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003214	5745180	MAG	United States	North America

• Gene Location: Start: 9480; End: 15701 Strand: -

Full Sequence      

MLEYKEKFPLTSVALAYLTGRDAKTELGGNATGFYAEFQGNCEAQRLEMAINRVIARQPM
LRTLLFSDGTQAELTKIPVYQLPVTDLQNYTCEEIEAFFQKLRAEESHRIFQLESWPMFN
FSFYLLPGGKSRVVISFDMMLMDRFSIEILVRELNAFYREERGPLKPLPHSYQDYVNLVE
DERRDNGEGDRKFWEQRIPHMPPAPPIAMKREGNSGGRFTSRVKVYGREQYQSLQERLYD
NHILPSVYMLYCYGKCLSRFSSANDMSVSMTIAHRAPMGHVFSDLIGDFTKLLLVDLHWD
AEENWIDGCRALHRRIKEYMKHTAFDGLDVMKEFAREHQLSGKAVFPFAFTSSLASQDES
HWHFLGDVVYQISRTPQLAVDCQISEHRGQLEIRWDCLKGILSDQFLDSMFWHYVDLVEK
TIDGQDSHAGIDIDRIALYNKTAADIPSRTLQTLFENQAAKTPSNPALSVDGETYTYGWL
RDASDRVASALYEKYGTGGAIMVDGQRTAETIVAILGILKSGNAYVPYDGEYPEKRIQSI
KESCHASALITPAVCRDMMAQGAPPFSAILGNPEDTAYIIFTSGSTGIPKGVVITQDAVC
NTILDVNHRFGLQETDCILGISSFWFDLSVYDIFGAFSTGAHLVVSQKVEMEHIVNLMNR
YPVTFWNTVPAILDLLVSSDPVLPRDILKNVLLSGDWIPLELPQKIHSLFPKAKVCSLGG
ATEASIWSIYYPIEKVEQNWNSIPYGYPLANQTIYVLDEAGRLCPTGVQGEICIGGRGVA
KEYCANEAETQAHFVDHPQYGRIYRTGDYGLMSEEGYVIFHGRMDQQIKLHGFRIELGEI
ESALLKCDAVDKAISLIRESASGASVIVAYVICRDRKVFDEASLRRAISESIPHYMLPSA
ILCVDEFPLTSNGKIDRKALPLPDIAESKKDLPRTQMESKIAEIWEKEMGATAVYREDNF
FYLGGDSLMGIRVAGQIQKELKIKVDVSEIFASPVLKEFCEGLERKRISGDGGEEELPAI
VVDSENENRPFPLTDVQRSYWIGAKGMMSLSGVTTHAVCELVCEDIEFERLEMAFNKVIA
EQGMMRAVVLRDGSQQILEKVPHYPISILEADEDTVEEMRQNIRSEIENERFNPEIWPLF
KVQAIRCRDTVFLYVDLDNLIFDGFSVQLLFSRWSEYYHNSAKNVEKLGVSFRDYVNALA
AVKQSAQYEIDQQYWKQQVLTMAPAPDLFTISSPDMLVAQTISHYTAKLDPQTWQQLQAN
SRAYGLTPATALLTAYSVLLSLWSRTSAFTINVTQYNRLFNHPEINALIGDFTLLSMLSV
DMSAPATFCEHAQRIQNKVSDNMAHPYFSGVEVQQEYAKLHQLGGVIFPIVFTCTVGMAS
GRSTERGLGKVERITTETPQVWLDCQVTELEGGLNISLEAVKELFPAETPAAMMEFYRKL
LLVLSEDRQIWKSSLQDILYPHNLIPTLRERERLSELAPVDRGSTLESLFVSQALRAPER
IAVIDRTRTMTYGQLYREALLLSEEIAGKNQSIVAILLKKGWRQVVAVVATLMSGAAYLP
LDMGNPDKRIEEILDKSQANLILTEADLAQRASGFGCDFIVISGKPMDTQLKEHPLQCTG
DSLAYCIFTSGSTGKPKGVMISHRGAVNTILDVNERFHIDHNDRTLALSALNFDLSVYDI
FGMLACGGAVVIPGEWDRKDPHALMELIHIYGVTVWNSVPAFMQMLAEYALEVKETAENL
RVVMLSGDWIPLDLTAKIRRLSQQADIYSLGGATEASIWSNYYPIREVKPEWRSIPYGYP
LSGQGFRILNDQMLDCPPNTIGKLYIFGTGVALGYLHDRALTGERFIEYGRTGERLYDTG
DLGMYWNDGTIEFWGREDFQVKIRGHRIELGEIEAAVNQSHLVKEAAAMAVKVKGKPSLA
AALVPIDGSYPKEEILADALGEAQKRLPDYMIPSICFVLPKMPLTGNGKIDRKELLAQAE
RLVGQQRRGEPEHKRDEIETLIGEIWQEVLGLDELPGLEEDFFDFGGDSIDIVKVKTKLS
ETLGQDIAMSKIFAAPTVSGMAQAVKGEGEGLL

Enzyme Prediction     

No EC number prediction in MGYG000003214_02778.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd12114	A_NRPS_TlmIV_like	0.0	1498	1975	1	477	The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes. The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions. This family includes the TLM biosynthetic gene cluster from Streptoalloteichus that consists of nine NRPS genes; the N-terminal module of TlmVI (NRPS-5) and the starter module of BlmVI (NRPS-5) are comprised of the acyl CoA ligase (AL) and acyl carrier protein (ACP)-like domains, which are thought to be involved in the biosynthesis of the beta-aminoalaninamide moiety.
PRK05691	PRK05691	0.0	39	2035	707	2746	peptide synthase; Validated
PRK12316	PRK12316	0.0	45	2069	1593	3626	peptide synthase; Provisional
PRK12467	PRK12467	0.0	39	2073	81	2170	peptide synthase; Provisional
cd12114	A_NRPS_TlmIV_like	3.58e-169	463	920	1	477	The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes. The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions. This family includes the TLM biosynthetic gene cluster from Streptoalloteichus that consists of nine NRPS genes; the N-terminal module of TlmVI (NRPS-5) and the starter module of BlmVI (NRPS-5) are comprised of the acyl CoA ligase (AL) and acyl carrier protein (ACP)-like domains, which are thought to be involved in the biosynthesis of the beta-aminoalaninamide moiety.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND46664.1	1.08e-172	439	2066	998	2663
ACX49739.1	2.93e-95	436	1723	447	1818
BAY90071.1	4.91e-80	40	1030	2268	3305
AFZ04852.1	3.68e-79	391	1006	517	1186
BAY30132.1	5.63e-79	40	1030	2279	3316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LY7_A	2.38e-218	3	1005	6	1018	ChainA, BmdB, Bacillamide NRPS [Thermoactinomyces vulgaris]
7LY4_E	2.46e-218	3	1005	6	1018	ChainE, BmdB, bacillamide NRPS [Thermoactinomyces vulgaris]
6MFZ_A	1.41e-168	449	2068	205	1800	Crystalstructure of dimodular LgrA in a condensation state [Brevibacillus parabrevis],6MFZ_B Crystal structure of dimodular LgrA in a condensation state [Brevibacillus parabrevis]
6MFY_A	3.83e-157	449	1975	205	1712	Crystalstructure of a 5-domain construct of LgrA in the substrate donation state [Brevibacillus parabrevis],6MG0_A Crystal structure of a 5-domain construct of LgrA in the thiolation state [Brevibacillus parabrevis],6MG0_B Crystal structure of a 5-domain construct of LgrA in the thiolation state [Brevibacillus parabrevis]
6LTA_A	3.69e-153	1012	2068	37	1101	ChainA, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTB_A Chain A, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTC_A Chain A, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTD_A Chain A, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23],6LTD_B Chain B, Nonribosomal peptide synthetase [Streptomyces sp. Sp080513GE-23]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O68006	3.75e-275	439	2070	26	1656	Bacitracin synthase 1 OS=Bacillus licheniformis OX=1402 GN=bacA PE=3 SV=1
P27206	1.03e-199	3	2066	1057	3109	Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAA PE=1 SV=4
O30409	3.46e-191	39	2070	1087	3116	Tyrocidine synthase 3 OS=Brevibacillus parabrevis OX=54914 GN=tycC PE=1 SV=1
O68007	3.04e-190	37	2068	105	2132	Bacitracin synthase 2 OS=Bacillus licheniformis OX=1402 GN=bacB PE=3 SV=1
P0C063	1.11e-185	40	2066	1094	3124	Gramicidin S synthase 2 OS=Aneurinibacillus migulanus OX=47500 GN=grsB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003214_02778.