CAZyme Information: MGYG000003214_02931

Basic Information

• Species: NSJ-32 sp014384895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; NSJ-32; NSJ-32 sp014384895
• CAZyme ID: MGYG000003214_02931
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686		76630.25	4.8077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003214	5745180	MAG	United States	North America

• Gene Location: Start: 68; End: 2128 Strand: -

Full Sequence      

MQQWNFYVSPSGNDKWSGLLASPSTDGNDGPFQTVQRARDAIRALRAAGRLYKDVTVHIR
GGEYPITEPISFTQLDSFPTTYKAYGEETPVFNGGVRLTDFTVETVNGVTAWTKDLPAVR
DGKWSFTQLYVNDTRRDRPRLPKDDYFWIDQADIGERQLFHGTDTFQYQNDDIQEYHNIQ
DVDIVVDHYWIDERMPIQWVNTATRTVKSTCRSVFVLTDDFTGRLAKYYLDNVFEALTEP
GQWYLDKVAGKLYYIPLPGETMDNTVITAPVTAQFITVTGLPESGDYVENLHFEGLTFAN
SDCRFPLIVETSEVNGYSFGLFHDGAQMRTFGTATQPIAGTPQGALHVPGVLYFEGAKHC
SVTDCTIKHIGWYGIELGEGCFGNTLAYNDIYDTGAGGIKLGGSTARGSLCRRNGANQIT
DNHIYDLTHVYHGATGILSIHSCDNTISHNHIHDMTYTGISCGWIWGYAENVSKNNKIEK
NLIHDLGKGVMSDMGGIYTLGVQPGTEINGNLIYNVEKNNYGGWGIYFDEGSSHIIAQNN
ICYNMSSQPFHQHYGRENTIRNNIFACGREGQLRITRKEDHMSVICERNIIITEGTGYFI
PAMDEVAAAGNIISDLNLFWTTGDPEAAEADLEGWKALGQDSHSVFADPGIRDLFHNQFD
LKEDSPAYAIGFKPIDMSDVGPRPRD

Enzyme Prediction     

No EC number prediction in MGYG000003214_02931.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	5	544	6.3e-108	0.9924098671726755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	6.29e-17	352	540	3	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.24e-13	373	563	1	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	1.28e-06	396	565	9	172	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam13229	Beta_helix	5.17e-04	495	615	1	112	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	0.006	352	515	66	169	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYM78419.1	5.98e-152	6	683	4	697
QHT69676.1	4.11e-138	4	686	23	691
BAY12871.1	1.25e-137	6	676	48	698
CCW33972.1	2.74e-134	5	681	29	678
QDP95960.1	2.61e-133	16	684	8	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	2.89e-29	7	540	28	580	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003214_02931.